PDGF-AB Recombinant Protein

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
40-512-0002mg	PDGF-AB Recombinant Protein
40-512-001mg	PDGF-AB Recombinant Protein
MBS537870-02	PDGF AB protein
30R-AP003	PDGF AB protein
MBS5304037-01	PDGF AB protein
MBS5304037-02	PDGF AB protein
MBS537870-01	PDGF AB protein
MBS537870-03	PDGF AB protein
30R-2610	PDGF AB protein
PROTP20033-2	Recombinant Human PDGF-AB Protein

CAT:

209-200-053

Size:

5 µg

Price:

Ask

For price, please contact [email protected].

PDGF-AB Recombinant Protein

Description: PDGFs are disulfide-linked dimers consisting of two 12.0-13.5 kDa polypeptide chains, designated PDGF-A and PDGF-B chains. The three naturally occurring PDGFs; PDGF-AA, PDGF-BB and PDGF-AB, are potent mitogens for a variety of cell types including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. The PDGFs are stored in platelet α-granules and are released upon platelet activation. The PDGFs are involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. Two distinct signaling receptors used by PDGFs have been identified and named PDGFR-α and PDGFR-β. PDGFR-α is high-affinity receptor for each of the three PDGF forms. On the other hand, PDGFR-β interacts with only PDGF-BB and PDGF-AB. Recombinant human PDGF-AB is a 25.5 kDa disulfide-linked dimer, consisting of one A chain and one B chains (234 total amino acids).
Synonyms: PDGFA; PDGF1; PDGF-A
NCBI Gene ID: 5154/5155
UniProt: P04085/P01127
Accession Number: NP_002599.1;NP_002598.2
Accession Number mRNA: NM_002608.2;NM_002607.5
Gene Location: 7p22/22q13.1
Host: E. coli
Origin Species: Human
Species Reactivity: Human
Sequence: Alpha chain: MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT Beta chain: MSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIGIVRKKPIFKKATVTLGDHLACKCETVAAARPVT
Detection Range: The biological activity was determined by the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts).
Endotoxin: < 0.1 ng per ug of PDGF-AB
Purity: > 95% by SDS-PAGE
Length: 126/110
Form: Lyophilized
Buffer: 50mM acetic acid
Reconstitution: Centrifuge vial prior to opening. The lyophilized PDGF-AB should be reconstituted in 50mM acetic acid to a concentration not lower than 100μg/ml. For long term storage of reconstituted protein addition of carrier protein (e.g. BSA or HSA; 0.1%) is recommended.
Molecular Weight: 25.5 kDa
Shipping Conditions: Room Temperature
Storage Conditions: The lyophilized PDGF-AB is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted PDGF-AB is best stored at -20°C to -70°C. Avoid repeated freeze-thaw cycles.

Complementary Product Range

Our range of products, including PDGF-AB Recombinant Protein, falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on

Cat	Name
200-054	PDGF-AB Recombinant Protein
200-053	PDGF-AB Recombinant Protein
200-053S	PDGF-AB Recombinant Protein
M10-125	PDGF-BB Recombinant Protein
100-354	PDGF-CC Recombinant Protein
200-052	PDGF-AA Recombinant Protein
M10-049S	PDGF-AA Recombinant Protein
M10-125S	PDGF-BB Recombinant Protein
100-354S	PDGF-CC Recombinant Protein
200-051	PDGF-AA Recombinant Protein