PDGF-AA Recombinant Protein

PDGF-AA Recombinant Protein

• Description: PDGFs are disulfide-linked dimers consisting of two 12.0-13.5 kDa polypeptide chains, designated PDGF-A and PDGF-B chains. The three naturally occurring PDGFs; PDGF-AA, PDGF-BB and PDGF-AB, are potent mitogens for a variety of cell types including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. The PDGFs are stored in platelet alpha-granules and are released upon platelet activation. The PDGFs are involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. Two distinct signaling receptors used by PDGFs have been identified and named PDGFR-alpha and PDGFR-beta. PDGFR-alpha is high-affinity receptor for each of the three PDGF forms. On the other hand, PDGFR-beta interacts with only PDGF-BB and PDGF-AB. Recombinant human PDGF-AA is a 28.5 kDa disulfide-linked homodimer of two A chains (250 total amino acids).
• Synonyms: PDGFA; PDGF1; PDGF-A
• CAS Number: 9000-83-3
• NCBI Gene ID: 5154
• UniProt: P04085
• Accession Number: NP_002598.5
• Accession Number mRNA: NM_002607.5
• Gene Location: 7p22
• Host: E. coli
• Origin Species: Human
• Species Reactivity: Human
• Sequence: SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
• Detection Range: The biological activity was determined by the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts).
• Endotoxin: < 0.1 ng per ug of PDGF-AA
• Purity: > 95% by SDS-PAGE
• Length: 125
• Form: Lyophilized
• Buffer: 50mM acetic acid
• Reconstitution: Centrifuge vial prior to opening. The lyophilized PDGF-AA should be reconstituted in water to a concentration not lower than 50 µg/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.
• Molecular Weight: 28.5 kDa
• Shipping Conditions: Room Temperature
• Storage Conditions: The lyophilized PDGF-AA is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted PDGF-AA is best stored at -20°C to -70°C. Avoid repeated freeze-thaw cycles.