PDGF-BB Recombinant Protein

• Description:

  PDGFs are disulfide-linked dimers consisting of two 12.0-13.5 kDa polypeptide chains, designated PDGF-A and PDGF-B chains. The three naturally occurring PDGFs; PDGF-AA, PDGF-BB and PDGF-AB, are potent mitogens for a variety of cell types including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. The PDGFs are stored in platelet alpha-granules and are released upon platelet activation. The PDGFs are involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. Two distinct signaling receptors used by PDGFs have been identified and named PDGFR-alpha and PDGFR-beta. PDGFR-alpha is high-affinity receptor for each of the three PDGF forms. On the other hand, PDGFR-beta interacts with only PDGF-BB and PDGF-AB. Recombinant human PDGF-BB is a 24.3 kDa disulfide-linked homodimer of two B chains (218 total amino acids).

• Synonyms:

  PDGF-2; Platelet-derived growth factor B chain; Platelet-derived growth factor beta polypeptide; Proto-oncogene c-Sis; INN=Becaplermin

• NCBI Gene ID:

  5155

• UniProt:

  P01127

• Accession Number:

  NP_002599.1

• Accession Number mRNA:

  NM_002608.2

• Gene Location:

  22q13.1

• Host:

  E. coli

• Origin Species:

  Human

• Species Reactivity:

  Human

• Sequence:

  SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

• Detection Range:

  The biological activity was determined by the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts).

• Endotoxin:

  < 0.1 ng per ug of PDGF-BB

• Purity:

  > 95% by SDS-PAGE

• Length:

  109

• Form:

  Lyophilized

• Buffer:

  50mM acetic acid

• Reconstitution:

  Centrifuge vial prior to opening. The lyophilized PDGF-BB should be reconstituted in 50mM acetic acid to a concentration not lower than 100μg/ml. For long term storage of reconstituted protein addition of carrier protein (e.g. BSA or HSA; 0.1%) is recommended.

• Molecular Weight:

  24.3 kDa

• Shipping Conditions:

  Room Temperature

• Storage Conditions:

  The lyophilized PDGF-BB is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted PDGF-BB is best stored at -20°C to -70°C.

• N Terminal Sequence:

  SLGSL

• CAS Number:

  9000-83-3