I-TAC (CXCL11) (Animal Free) Recombinant Protein

I-TAC (CXCL11) (Animal Free) Recombinant Protein

• Description: I-TAC is a 'non-ELR' CXC chemokine that is regulated by interferon and signals through the CXCR3 receptor. I-TAC is chemoattractant for IL-2 activated T cells, but does not affect freshly isolated un-stimulated T cells, neutrophils, ormonocytes. Recombinant Human I-TAC (CXCL11) is an 8.3 kDa protein containing 73 amino acid residues, including the four highly conserved cysteine residues present in CXC chemokines.
• Synonyms: CXCL11; IP9; H174; IP-9; b-R1; I-TAC; SCYB11; SCYB9B
• CAS Number: 9000-83-3
• NCBI Gene ID: 6373
• UniProt: O14625
• Accession Number: NP_005400.1
• Accession Number mRNA: NM_005409.4
• Gene Location: 4q21.2
• Host: E. coli
• Origin Species: Human
• Species Reactivity: Hamster, Mouse, Rabbit, Human, Monkey
• Sequence: FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
• Detection Range: Determined by its ability to chemoattract human T-cells activated with IL-2.
• Endotoxin: < 0.01 ng/ug of protein (< 0.1 EU/ug)
• Purity: ≥ 98% by SDS-PAGE gel and HPLC analyses.
• Length: 73
• Form: Lyophilized
• Molecular Weight: 8.3 kDa
• Shipping Conditions: Room Temperature