I-TAC (CXCL11) Recombinant Protein

I-TAC (CXCL11) Recombinant Protein

• Description: Human I-TAC (Interferon-inducible T cell alpha chemoacttractant) is an 8.3 kDa protein containing 73 amino acid residues. I-TAC is a novel non-ELR CXC chemokine. It is regulated by Interferon and has potent chemoattractant activity for IL-2 activated T cells, but not for freshly isolated unstimulated T cells, neutrophils, or monocytes.
• Synonyms: CXCL11; IP9; H174; IP-9; b-R1; I-TAC; SCYB11; SCYB9B
• CAS Number: 9000-83-3
• NCBI Gene ID: 6373
• UniProt: O14625
• Accession Number: NP_005400.1
• Accession Number mRNA: NM_005409.4
• Gene Location: 4q21.2
• Host: E. coli
• Origin Species: Human
• Species Reactivity: Hamster, Mouse, Rabbit, Human, Monkey
• Sequence: FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
• Detection Range: Determined by its ability to chemoattract IL-2 activated T-cells using a concentration range of 0.1-10.0 ng/ml.
• Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
• Purity: > 98% by SDS-PAGE & HPLC analyses
• Length: 73
• Form: Lyophilized
• Molecular Weight: 8.3 kDa
• Shipping Conditions: Room Temperature