I-TAC (CXCL11) Recombinant Protein

I-TAC (CXCL11) Recombinant Protein

• Description: I-TAC is a "non-ELR" CXC chemokine that is regulated by interferon and signals through the CXCR3 receptor. I-TAC is chemoattractant for IL-2 activated T cells, but does not affect freshly isolated un-stimulated T cells, neutrophils, or monocytes. Recombinant murine I-TAC is a 9.0 kDa protein containing 79 amino acid residues including the four highly conserved cysteine residues present in CXC chemokines.
• Synonyms: CXCL11
• CAS Number: 9000-83-3
• NCBI Gene ID: 56066
• UniProt: Q9JHH5
• Accession Number: NP_062367.1
• Accession Number mRNA: NM_019494.1
• Gene Location: 5; 5 E3
• Host: E. coli
• Origin Species: Mouse
• Species Reactivity: Human, Mouse, Monkey, Bacteria
• Sequence: FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM
• Detection Range: Determined by its ability to chemoattract murine CXCR3 transfected HEK/293 cells using a concentration range of 10.0-100.0 ng/ml.
• Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
• Purity: > 98% by SDS-PAGE & HPLC analyses
• Length: 79
• Form: Lyophilized
• Molecular Weight: 9.0 kDa
• Shipping Conditions: Room Temperature