I-TAC (CXCL11) Recombinant Protein
CAT:
209-M10-086S
Size:
5 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No

I-TAC (CXCL11) Recombinant Protein
- Description: I-TAC is a "non-ELR" CXC chemokine that is regulated by interferon and signals through the CXCR3 receptor. I-TAC is chemoattractant for IL-2 activated T cells, but does not affect freshly isolated un-stimulated T cells, neutrophils, or monocytes. Recombinant murine I-TAC is a 9.0 kDa protein containing 79 amino acid residues including the four highly conserved cysteine residues present in CXC chemokines.
- Synonyms: CXCL11
- CAS Number: 9000-83-3
- NCBI Gene ID: 56066
- UniProt: Q9JHH5
- Accession Number: NP_062367.1
- Accession Number mRNA: NM_019494.1
- Gene Location: 5; 5 E3
- Host: E. coli
- Origin Species: Mouse
- Species Reactivity: Human, Mouse, Monkey, Bacteria
- Sequence: FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM
- Detection Range: Determined by its ability to chemoattract murine CXCR3 transfected HEK/293 cells using a concentration range of 10.0-100.0 ng/ml.
- Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
- Purity: > 98% by SDS-PAGE & HPLC analyses
- Length: 79
- Form: Lyophilized
- Molecular Weight: 9.0 kDa
- Shipping Conditions: Room Temperature