EGF Recombinant Protein

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
96-361	Glyco Recombinant Protein A33 Recombinant Protein
96-656	Protein L Recombinant Protein
CD00147-5mg	Recombinant protein G protein
91-317	Protein FAM3C Recombinant Protein
91-318	Protein FAM3D Recombinant Protein
96-364	Glyco Recombinant Protein A33 Recombinant Protein
PROTP14847	Mouse C-Reactive Recombinant Protein/CRP Recombinant Protein
96-655	Protein G Recombinant Protein
91-235	Protein CutA Recombinant Protein
GWB-Q00384	RECOMBINANT PROTEIN G:HRP Protein

CAT:

209-100-008

Size:

100 µg

Price:

Ask

For price, please contact [email protected].

EGF Recombinant Protein

Description: Epidermal growth factor (EGF) is the founding member of the EGF family that also includes TGFα, amphiregulin (AR), betacellulin (BTC), epiregulin (EPR), heparin-binding EGF-like growth factor (HBEGF), epigen, and the neuregulins (NRG) 1 through 6. Members of the EGF family share a structural motif, the EGF-like domain, which is characterized by three intra-molecular disulfide bonds that are formed by six similarly spaced conserved cysteine residues. All EGF family members are synthesized as type I transmembrane precursor proteins that may contain several EGF domains in the extracellular region. The mature proteins are released from the cell surface by regulated proteolysis. The 1207 amino acid (aa) human EGF precursor contains nine EGF domains and nine LDLR class B repeats. The mature protein consists of 53 aa and is generated by proteolytic excision of the EGF domain proximal to the transmembrane region. Mature human EGF shares 70% aa sequence identity with mature mouse and rat EGF. EGF is present in various body fluids, including blood, milk, urine, saliva, seminal fluid, pancreatic juice, cerebrospinal fluid, and amniotic fluid. Four ErbB (HER) family receptor tyrosine kinases including EGFR/ErbB1, ErbB2, ErbB3 and ErbB4, mediate responses to EGF family members. EGF binds ErbB1 and depending on the context, induces the formation of homodimers or heterodimers containing ErbB2. Biological activities ascribed to EGF include epithelial development, angiogenesis, inhibition of gastric acid secretion, fibroblast proliferation, and colony formation of epidermal cells in culture.
Synonyms: Epidermal growth factor; EGF; URG; HOMG4; Urogastrone
NCBI Gene ID: 1950
UniProt: P01133
Accession Number: NP_001954.2
Accession Number mRNA: NM_1963.4
Gene Location: 4q25
Host: E. coli
Origin Species: Human
Species Reactivity: human, mouse
Sequence: MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Detection Range: The biological activity was determined by the ability to induce EGF receptor phosphorylation in the A431 tumor cell line [Soler et al, J Chromatography B, 788, 2003] and the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts).
Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
Purity: > 95% by SDS-PAGE
Length: 54
Form: Lyophilized
Buffer: PBS
Reconstitution: We recommend a quick spin followed by reconstitution in water to a concentration of 0.1-1.0 mg/ml.
Molecular Weight: 6.35 kDa
Shipping Conditions: Room Temperature
Storage Conditions: The lyophilized protein is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted EGF should be stored in working aliquots at -20°C.

Complementary Product Range

Our range of products, including EGF Recombinant Protein, falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on

Cat	Name
100-434	Vimentin Recombinant Protein
500-061S	Leptin Recombinant Protein
500-072S	Leptin Recombinant Protein
100-124	ApoE2 Recombinant Protein
500-073	Leptin Recombinant Protein
M10-028	Leptin Recombinant Protein
M10-116S	GDNF Recombinant Protein
M30-001S	VEGF164 Recombinant Protein
M30-031S	VEGF120 Recombinant Protein
R20-040S	SCF Recombinant Protein