TPO Recombinant Protein
CAT:
209-M10-087S
Size:
2 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
TPO Recombinant Protein
- Description: TPO is a lineage specific growth factor, produced in the liver, kidney and skeletal muscle. It stimulates the proliferation and maturation of megakaryocytes, and promotes increased circulating levels of platelets in vivo. TPO signals through the c-mpl receptor and acts as an important regulator of circulating platelets. Human and murine TPO exhibits cross-species reactivity. Recombinant murine TPO is a fully biologically active 174 amino acid polypeptide (18.7 kDa), which contains the erythropoietin-like domain of the full length TPO protein.
- Synonyms: TPO, Thrombopoietin, MGDF, Megakaryocyte colony-stimulating factor, c-MPL Ligand
- CAS Number: 9000-83-3
- NCBI Gene ID: 22018
- UniProt: P40226
- Accession Number: NP_033405.1
- Accession Number mRNA: NM_009379.3
- Gene Location: 12 C; 12 15.0 cM
- Host: E. coli
- Origin Species: Mouse
- Species Reactivity: Human, Mouse
- Sequence: SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKF
- Detection Range: The ED50 as determined by the dose-dependent stimulation of the proliferation of human MO7e cells was found to be < 1.0 ng/ml, corresponding to a specific activity of > 1 x 106 units/mg.
- Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
- Purity: > 98% by SDS-PAGE & HPLC analyses
- Length: 174
- Form: Lyophilized
- Molecular Weight: 18.7 kDa
- Shipping Conditions: Room Temperature