Products for Research Use Only
RegisterLogin

Recombinant human Anaphase-promoting complex subunit 15

CAT: 0247-OPCA00027-20UGSize: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0247-OPCA00027-20UGSize:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
CAS Number
9000-83-3
Gene Name
Anaphase promoting complex subunit 15
Gene Aliases
Anaphase-promoting complex subunit 15; APC15; C11orf51; HSPC020.
Gene ID
25906
Reactivity
Homo sapiens|Human
Target
Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. In the complex, plays a role in the release of the mitotic checkpoint complex (MCC) from the APC/C: not required for APC/C activity itself, but promotes the turnover of CDC20 and MCC on the APC/C, thereby participating in the responsiveness of the spindle assembly checkpoint. Also required for degradation of CDC20.
Type
Protein
Source
E.coli
Sequence
MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
41.3 kDa
Protein Length
Recombinant
NCBI Gene Symbol
ANAPC15
Protein Name
Anaphase-promoting complex subunit 15
Gene Name URL
ANAPC15

Related Products

CatalogName
OPCA00567-100UGRecombinant human Anaphase-promoting complex subunit 5 protein
OPCA00567-20UGRecombinant human Anaphase-promoting complex subunit 5 protein
OPCA00567-1MGRecombinant human Anaphase-promoting complex subunit 5 protein
OPCA00371-100UGRecombinant human Proteasome activator complex subunit 2
OPCA00371-20UGRecombinant human Proteasome activator complex subunit 2
OPCA00371-1MGRecombinant human Proteasome activator complex subunit 2
OPCA00008-100UGRecombinant human AP-1 complex subunit sigma-3
OPCA00008-20UGRecombinant human AP-1 complex subunit sigma-3
OPCA00525-100UGRecombinant human Cytochrome b-c1 complex subunit 8
OPCA00008-1MGRecombinant human AP-1 complex subunit sigma-3

Alternative Products

CatalogName
305945Anaphase promoting complex subunit 2
475205ANAPC7 (Anaphase-Promoting Complex Subunit 7)
305947APC5 (Anaphase-promoting complex subunit 5)
475202ANAPC15 (Anaphase-Promoting Complex Subunit 15)
305948-01Anaphase-promoting complex subunit 10 (ANAPC10)
475201ANAPC10 (Anaphase-Promoting Complex Subunit 10)
305943APC1 (Anaphase promoting complex subunit 1)
475203ANAPC5 (Anaphase Promoting Complex Subunit 5)
137409APC3 (Anaphase-promoting Complex Subunit 3)
MBS717683-01Recombinant Human Anaphase-promoting complex subunit 15

Popular Products