Products for Research Use Only
RegisterLogin

Recombinant human AP-1 complex subunit sigma-3

CAT: 0247-OPCA00008-100UGSize: 100 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0247-OPCA00008-100UGSize:100 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
CAS Number
9000-83-3
Gene Name
Adaptor related protein complex 1 subunit sigma 3
Gene Aliases
Adapter-related protein complex 1 subunit sigma-1C; adaptor protein complex AP-1 sigma-1C subunit; Adaptor protein complex AP-1 subunit sigma-1C; adaptor related protein complex 1 sigma 3 subunit; adaptor-related protein complex 1 subunit sigma-1C; AP-1 complex subunit sigma-3; clathrin assembly protein complex 1 sigma-1C small chain; golgi adaptor HA1/AP1 adaptin sigma-1C subunit; PSORS15; sigma 1C subunit of AP-1 clathrin; sigma1C; Sigma1C-adaptin; Sigma-adaptin 1C.
Gene ID
130340
Reactivity
Homo sapiens|Human
Target
Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. Involved in TLR3 trafficking (PubMed:24791904) .
Type
Protein
Source
E.coli
Sequence
MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNTWPFARA
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
39.7 kDa
Protein Length
Recombinant
NCBI Gene Symbol
AP1S3
Protein Name
AP-1 complex subunit sigma-3
Gene Name URL
AP1S3

Related Products

CatalogName
OACA00129-100UGRabbit anti-human AP-1 complex subunit sigma-3
OPCA00221-20UGRecombinant human 14-3-3 protein sigma
OPCA00221-1MGRecombinant human 14-3-3 protein sigma
OPCA00221-100UGRecombinant human 14-3-3 protein sigma
OPCA00500-100UGRecombinant human Actin-related protein 2/3 complex subunit 3
OPCA00500-20UGRecombinant human Actin-related protein 2/3 complex subunit 3
OPCA00500-1MGRecombinant human Actin-related protein 2/3 complex subunit 3
OPCA00027-100UGRecombinant human Anaphase-promoting complex subunit 15
OPCA00027-1MGRecombinant human Anaphase-promoting complex subunit 15
OPCA00371-100UGRecombinant human Proteasome activator complex subunit 2

Alternative Products

CatalogName
306262-01AP-1 complex subunit sigma-3
306265-01AP-1 complex subunit sigma-3 (HRP)
306263-01AP-1 complex subunit sigma-3 (Biotin)
306264-01AP-1 complex subunit sigma-3 (FITC)
475374AP3S1 (AP-3 Complex Subunit Sigma-1, Adaptor-Related Protein Complex 3, Sigma 1 Subunit)
MBS9419996-01Recombinant Human AP-1 complex subunit sigma-3
MBS9415372-01AP-1 complex subunit sigma-3 Polyclonal Antibody
abx109545-01AP-1 Complex Subunit Sigma 3 (AP1S3) Antibody
abx106569-01AP-1 complex subunit sigma 3 Antibody (FITC)
abx107986-01AP-1 complex subunit sigma 3 Antibody (HRP)

Popular Products