Recombinant human AP-1 complex subunit sigma-3

• Gene Name:

  Adaptor related protein complex 1 subunit sigma 3

• Gene Aliases:

  Adapter-related protein complex 1 subunit sigma-1C; adaptor protein complex AP-1 sigma-1C subunit; Adaptor protein complex AP-1 subunit sigma-1C; adaptor related protein complex 1 sigma 3 subunit; adaptor-related protein complex 1 subunit sigma-1C; AP-1 complex subunit sigma-3; clathrin assembly protein complex 1 sigma-1C small chain; golgi adaptor HA1/AP1 adaptin sigma-1C subunit; PSORS15; sigma 1C subunit of AP-1 clathrin; sigma1C; Sigma1C-adaptin; Sigma-adaptin 1C.

• Gene ID:

  130340

• Reactivity:

  Homo sapiens|Human

• Target:

  Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. Involved in TLR3 trafficking (PubMed:24791904) .

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNTWPFARA

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  39.7 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  AP1S3

• Protein Name:

  AP-1 complex subunit sigma-3

• Gene Name URL:

  AP1S3

• CAS Number:

  9000-83-3