Products for Research Use Only
RegisterLogin

Recombinant human Cytochrome b-c1 complex subunit 8

CAT: 0247-OPCA00525-100UGSize: 100 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0247-OPCA00525-100UGSize:100 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
CAS Number
9000-83-3
Gene Name
Ubiquinol-cytochrome c reductase complex III subunit VII
Gene Aliases
Complex III subunit 8; complex III subunit VIII; cytochrome b-c1 complex subunit 8; low molecular mass ubiquinone-binding protein (9.5kD) ; MC3DN4; QCR8; QPC; QP-C; ubiquinol-cytochrome c reductase complex 9.5 kDa protein; ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C; ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa; UQCR7.
Gene ID
27089
Reactivity
Homo sapiens|Human
Target
This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone.
Type
Protein
Source
E.coli
Sequence
GREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAY
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
36.3 kDa
Protein Length
Recombinant
NCBI Gene Symbol
UQCRQ
Protein Name
Cytochrome b-c1 complex subunit 8
Gene Name URL
UQCRQ

Related Products

CatalogName
OPCA00523-20UGRecombinant human Cytochrome b-c1 complex subunit 10 protein
OPCA00523-1MGRecombinant human Cytochrome b-c1 complex subunit 10 protein
OPCA00523-100UGRecombinant human Cytochrome b-c1 complex subunit 10 protein
OPCA00553-20UGRecombinant human Cytochrome b-c1 complex subunit Rieske, mitochondrial protein
OPCA00553-1MGRecombinant human Cytochrome b-c1 complex subunit Rieske, mitochondrial protein
OPCA00553-100UGRecombinant human Cytochrome b-c1 complex subunit Rieske, mitochondrial protein
OPCA00027-1MGRecombinant human Anaphase-promoting complex subunit 15
OPCA00371-100UGRecombinant human Proteasome activator complex subunit 2
OPCA00027-100UGRecombinant human Anaphase-promoting complex subunit 15
OPCA00027-20UGRecombinant human Anaphase-promoting complex subunit 15

Alternative Products

CatalogName
312790-01Cytochrome b-c1 complex subunit 8
GTR18022312Cytochrome b-c1 complex subunit 6 Antibody
GTR18022290Cytochrome b-c1 complex subunit 7 Antibody
495224UQCRQ (Cytochrome b-c1 Complex Subunit 8)
abx110484-01Cytochrome b-c1 complex subunit 10 Antibody
312791-01Cytochrome b-c1 complex subunit 8 (FITC)
GTR18022346Cytochrome b-c1 complex subunit 9 Antibody
312792-01Cytochrome b-c1 complex subunit 8 (HRP)
GTR18022301Cytochrome b-c1 complex subunit 8 Antibody
312793-01Cytochrome b-c1 complex subunit 8 (Biotin)

Popular Products