Recombinant Mouse TNF alpha

Recombinant Mouse TNF alpha

• Description: Tumor necrosis factor alpha (TNFSF2, TNF alpha) is a member of the TNF Superfamily. TNF alpha, being an endogenous pyrogen, is able to induce fever, to induce apoptotic cell death, to induce sepsis (through IL-1 & IL-6 production), to induce cachexia, induce inflammation, and to inhibit tumorigenesis and viral replication. Mouse TNF alpha Recombinant Protein is purified TNF alpha (TNFSF2) produced in yeast.
• CAS Number: 9000-83-3
• Source: Yeast
• Sequence: LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYS QVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLG GVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL (156)
• Assay Principle: The Mouse IL-6 protein can be used in cell culture, as an IL-6 ELISA Standard, and as a Western Blot Control.
• Shipping Conditions: Dry Ice
• Storage Conditions: -20°C