Recombinant Mouse APRIL
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: Yes


Recombinant Mouse APRIL
Description :
A proliferation-inducing ligand (APRIL), also known as TNFSF13, is a member of the tumor necrosis factor (TNF) ligand superfamily. APRIL/TNFSF13 has been shown to play a role in protecting cells from undergoing apoptosis and promoting B cell development. Mouse APRIL Recombinant Protein is purified APRIL (TNFSF13) produced in yeast.CAS Number :
9000-83-3Source :
YeastSequence :
AVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYL LYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDI ITVKIPRANAKLSLSPHGTFLGFVKL (146)Assay Principle :
The Mouse VEGF-A protein can be used in cell culture, as a VEGF-A ELISA Standard, and as a Western Blot Control.Shipping Conditions :
Dry IceStorage Conditions :
-20°C

