Alpha Synuclein Monomers: Biotinylated (C-terminus)

• Background:

  A 15 amino acid tag on the C-terminal tail of Alpha Synuclein facilitates site-specific covalent biotinylation (1). Biotinylation of purified alpha synuclein allows for many biological applications, such as monitoring and detection using streptavidin-based conjugates (1, 2, 3). Our biotinylated monomers are also used to generate pre-formed fibrils in-vitro.

• Description:

  Human Recombinant Alpha Synuclein Monomers: Biotinylated (C-terminus)

• Product Name Alternative:

  Alpha synuclein monomer, Alpha-synuclein monomer, Alpha synuclein protein monomer, Alpha synuclein monomer, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, Alpha synuclein monomers, SYN protein, Parkinson disease familial 1 Protein

• UNSPSC:

  12352202

• Swiss Prot:

  P37840

• Host:

  E. coli

• Origin Species:

  Human

• Target:

  Alpha Synuclein Biotinylated (C-terminus)

• Conjugation:

  C-terminal 15 amino acid tag: biotinylated

• Sequence:

  MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVH GVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEAGLNDIFEAQK IEWHE

• Applications:

  WB, SDS PAGE, In vitro Assay, In vivo Assay

• Purification Method:

  Ion-exchange Purified

• Concentration:

  2 mg/ml or 5 mg/ml

• Purity:

  > 95% based on SDS-PAGE and nanodrop analysis.

• Weight:

  0.05

• Length:

  155 aa

• Buffer:

  PBS pH 7.4

• Molecular Weight:

  16.27 kDa

• Precautions:

  Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

• Additionnal Information:

  For corresponding PFFs, see catalog# SPR-508.

• References & Citations:

  1. Fairhead & Howarth. 2015. Site-specific biotinylation of purified proteins using BirA. Methods in Molecular Biology. DOI: 1007/978-1-4939-2272-7_12 2. Hallacli et al. 2022. The Parkinson’s disease protein alpha synuclein is a modulator of Processing-bodies and mRNA stability. Cell. DOI: 10.1016/j.cell.2022.05.008 3. Li et al. 2019. Naturally occurring antibodies isolated from PD patients inhibit synuclein seeding in vitro and recognize Lewy pathology. Acta neuropathologica. DOI: 10.1007/s00401-019-01974-5.