Alpha Synuclein Monomers

CAT:
400-SPR-481B
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: Yes
Alpha Synuclein Monomers - image 1

Alpha Synuclein Monomers

  • Background :

    Alpha-Synuclein (SNCA) is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals (1) . Alpha-synuclein is highly expressed in the mitochondria of the olfactory bulb, hippocampus, striatum and thalamus (2) . Functionally, it has been shown to significantly interact with tubulin (3), and may serve as a potential microtubule-associated protein. It has also been found to be essential for normal development of the cognitive functions; inactivation may lead to impaired spatial learning and working memory (4) . SNCA fibrillar aggregates represent the major non A-beta component of Alzheimers disease amyloid plaque, and a major component of Lewy body inclusions, and Parkinson's disease. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin (5, 6) . The A53T mutation is a missense point mutation where alanine is replaced by threonine at the 53rd amino acid. This mutation has been linked to early-onset Parkinson's Disease and increased rates of alpha synuclein fibrillization.
  • Description :

    Rat Recombinant Alpha Synuclein Monomers
  • Product Name Alternative :

    Alpha synuclein pre-formed fibrils, Alpha synuclein aggregates, Alpha synuclein protein aggregates, Alpha synuclein aggregates, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkison disease familial 1 Protein
  • UNSPSC :

    12352202
  • UN Code :

    Non-hazardous
  • Hazard Statement :

    Non-hazardous
  • Gene ID :

    29219
  • Swiss Prot :

    P37377
  • Accession Number :

    NP_062042.1
  • Cellular Locus :

    Cytoplasm | Membrane | Nucleus
  • Expression System :

    E. coli
  • Host :

    E. coli
  • Origin Species :

    Rat
  • Target :

    Alpha Synuclein
  • Conjugation :

    No Tag
  • Nature :

    Recombinant
  • Sequence :

    MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTK EQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDP SSEAYEMPSEEGYQDYEPEA
  • Applications :

    WB | SDS-PAGE | In vivo assay | In vitro assay
  • Field of Research :

    Neuroscience | Neurodegeneration | Alzheimer's Disease | Tangles & Tau | Neuroscience | Neurodegeneration | Parkinson's Disease | Synuclein | Neuroscience | Neurodegeneration | Multiple System Atrophy
  • Purification Method :

    Ion-exchange Purified
  • Purification :

    Ion-exchange Purified
  • Limit Of Detection :

    Certified >95% pure using SDS-PAGE analysis. Low endotoxin <5 EU/mL @ 2mg/mL.
  • Concentration :

    2 mg/ml
  • Purity :

    >95%
  • Weight :

    0.01
  • Length :

    Full Length
  • Buffer :

    PBS pH 7.4
  • Molecular Weight :

    14.515 kDa
  • Precautions :

    Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
  • Additionnal Information :

    For corresponding PFFs, see catalog# SPR-482
  • References & Citations :

    1. “Genetics Home Reference: SNCA”. US National Library of Medicine. (2013). 2. Zhang L., et al. (2008) Brain Res. 1244: 40-52. 3. Alim M.A., et al. (2002) J Biol Chem. 277(3): 2112-2117. 4. Kokhan V.S., Afanasyeva M.A., Van'kin G. (2012) Behav. Brain. Res. 231(1): 226-230. 5. Spillantini M.G., et al. (1997) Nature. 388(6645): 839-840. 6. Mezey E., et al. (1998) Nat Med. 4(7): 755-757. 7. Polymeropoulos, M. H. (1998). Science. 276(5321), 2045–2047 8. Conway, K.E., et al. (1998). Nat Med. 4(11):1318-20
  • Shipping Conditions :

    Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
  • Storage Conditions :

    -80ºC
  • Notes :

    For corresponding PFFs, see catalog# SPR-482
  • Protein Length :

    Full Length
  • Background Reference 01 :

    1. “Genetics Home Reference: SNCA”. US National Library of Medicine. (2013) . 2. Zhang L., et al. (2008) Brain Res. 1244: 40-52. 3. Alim M.A., et al. (2002) J Biol Chem. 277 (3) : 2112-2117. 4. Kokhan V.S., Afanasyeva M.A., Van'kin G. (2012) Behav. Brain. Res. 231 (1) : 226-230. 5. Spillantini M.G., et al. (1997) Nature. 388 (6645) : 839-840. 6. Mezey E., et al. (1998) Nat Med. 4 (7) : 755-757. 7. Polymeropoulos, M. H. (1998) . Science. 276 (5321), 2045–2047 8. Conway, K.E., et al. (1998) . Nat Med. 4 (11) :1318-20
  • Location :

    Cytoplasm | Membrane | Nucleus
  • AA Sequence :

    MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTK EQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDP SSEAYEMPSEEGYQDYEPEA
  • Immunogen Species :

    Rat
MSDS

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide