Alpha Synuclein Monomers

• Background :

  Alpha-Synuclein (SNCA) is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals (1) . Alpha-synuclein is highly expressed in the mitochondria of the olfactory bulb, hippocampus, striatum and thalamus (2) . Functionally, it has been shown to significantly interact with tubulin (3), and may serve as a potential microtubule-associated protein. It has also been found to be essential for normal development of the cognitive functions; inactivation may lead to impaired spatial learning and working memory (4) . SNCA fibrillar aggregates represent the major non A-beta component of Alzheimers disease amyloid plaque, and a major component of Lewy body inclusions, and Parkinson's disease. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin (5, 6) . The A53T mutation is a missense point mutation where alanine is replaced by threonine at the 53rd amino acid. This mutation has been linked to early-onset Parkinson's Disease and increased rates of alpha synuclein fibrillization.

• Description :

  Rat Recombinant Alpha Synuclein Monomers

• Product Name Alternative :

  Alpha synuclein pre-formed fibrils, Alpha synuclein aggregates, Alpha synuclein protein aggregates, Alpha synuclein aggregates, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkison disease familial 1 Protein

• UNSPSC :

  12352202

• UN Code :

  Non-hazardous

• Hazard Statement :

  Non-hazardous

• Gene ID :

  29219

• Swiss Prot :

  P37377

• Accession Number :

  NP_062042.1

• Cellular Locus :

  Cytoplasm | Membrane | Nucleus

• Expression System :

  E. coli

• Host :

  E. coli

• Origin Species :

  Rat

• Target :

  Alpha Synuclein

• Conjugation :

  No Tag

• Nature :

  Recombinant

• Sequence :

  MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTK EQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDP SSEAYEMPSEEGYQDYEPEA

• Applications :

  WB | SDS-PAGE | In vivo assay | In vitro assay

• Field of Research :

  Neuroscience | Neurodegeneration | Alzheimer's Disease | Tangles & Tau | Neuroscience | Neurodegeneration | Parkinson's Disease | Synuclein | Neuroscience | Neurodegeneration | Multiple System Atrophy

• Purification Method :

  Ion-exchange Purified

• Purification :

  Ion-exchange Purified

• Limit Of Detection :

  Certified >95% pure using SDS-PAGE analysis. Low endotoxin <5 EU/mL @ 2mg/mL.

• Concentration :

  2 mg/ml

• Purity :

  >95%

• Weight :

  0.01

• Length :

  Full Length

• Buffer :

  PBS pH 7.4

• Molecular Weight :

  14.515 kDa

• Precautions :

  Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

• Additionnal Information :

  For corresponding PFFs, see catalog# SPR-482

• References & Citations :

  1. “Genetics Home Reference: SNCA”. US National Library of Medicine. (2013). 2. Zhang L., et al. (2008) Brain Res. 1244: 40-52. 3. Alim M.A., et al. (2002) J Biol Chem. 277(3): 2112-2117. 4. Kokhan V.S., Afanasyeva M.A., Van'kin G. (2012) Behav. Brain. Res. 231(1): 226-230. 5. Spillantini M.G., et al. (1997) Nature. 388(6645): 839-840. 6. Mezey E., et al. (1998) Nat Med. 4(7): 755-757. 7. Polymeropoulos, M. H. (1998). Science. 276(5321), 2045–2047 8. Conway, K.E., et al. (1998). Nat Med. 4(11):1318-20

• Shipping Conditions :

  Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.

• Storage Conditions :

  -80ºC

• Notes :

  For corresponding PFFs, see catalog# SPR-482

• Protein Length :

  Full Length

• Background Reference 01 :

  1. “Genetics Home Reference: SNCA”. US National Library of Medicine. (2013) . 2. Zhang L., et al. (2008) Brain Res. 1244: 40-52. 3. Alim M.A., et al. (2002) J Biol Chem. 277 (3) : 2112-2117. 4. Kokhan V.S., Afanasyeva M.A., Van'kin G. (2012) Behav. Brain. Res. 231 (1) : 226-230. 5. Spillantini M.G., et al. (1997) Nature. 388 (6645) : 839-840. 6. Mezey E., et al. (1998) Nat Med. 4 (7) : 755-757. 7. Polymeropoulos, M. H. (1998) . Science. 276 (5321), 2045–2047 8. Conway, K.E., et al. (1998) . Nat Med. 4 (11) :1318-20

• Location :

  Cytoplasm | Membrane | Nucleus

• AA Sequence :

  MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTK EQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDP SSEAYEMPSEEGYQDYEPEA

• Immunogen Species :

  Rat