RBP7, Human

• UNSPSC Description:

  RBP7 is pivotal in intracellularly transporting retinol. RBP7 Protein, Human is the recombinant human-derived RBP7 protein, expressed by E. coli , with tag free. The total length of RBP7 Protein, Human is 134 a.a., with molecular weight of ~14.0 kDa.

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/rbp7-protein-human.html

• Smiles:

  MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA

• Molecular Weight:

  Approximately 14.0 kDa

• Shipping Conditions:

  Room temperature