RBP5, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


RBP5, Human
Description :
RBP5 actively transports retinol intracellularly. RBP5 Protein, Human is the recombinant human-derived RBP5 protein, expressed by E. coli , with tag free.Product Name Alternative :
RBP5 Protein, Human, Human, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsAssay Protocol :
https://www.medchemexpress.com/cytokines/rbp5-protein-human.htmlSmiles :
MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVRMolecular Formula :
83758 (Gene_ID) P82980 (M1-R135) (Accession)Molecular Weight :
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.Shipping Conditions :
Room temperature in continental US; may vary elsewhere.Scientific Category :
Recombinant Proteins

