RBP1, Human

• Description :

  RBP1 Protein, a cytoplasmic retinol-binding protein, functions in retinol uptake, storage, and retinoid homeostasis by accepting retinol from the transport protein STRA6. The interaction between RBP1 and STRA6 occurs specifically in the retinol-free apoprotein state. RBP1 Protein, Human is the recombinant human-derived RBP1 protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  RBP1 Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/rbp1-protein-human.html

• Purity :

  98.0

• Smiles :

  PVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ

• Molecular Formula :

  5947 (Gene_ID) P09455 (P2-Q135) (Accession)

• Molecular Weight :

  Approximately 14.0 kDa

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins