BID, Human

• Description:

  BID Protein, Human expresses in E. coli. The BH3-only protein BID, a pro-apoptotic member of the Bcl-2 family, was initially discovered through binding to both pro-apoptotic Bax and anti-apoptotic Bcl-2. BID is activated in the BCL-2-regulated or mitochondrial apoptosis pathway and acts as a switch between the extrinsic and intrinsic cell death pathways[1].

• Product Name Alternative:

  BID Protein, Human, Human, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/bid-protein-human.html

• Purity:

  98.0

• Smiles:

  MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD

• Molecular Formula:

  637 (Gene_ID) P55957 (M1-D195) (Accession)

• Molecular Weight:

  Approximately 20.0 kDa

• References & Citations:

  [1]Billen LP, et al. Bid: a Bax-like BH3 protein. Oncogene. 2008;27 Suppl 1:S93-S104.

• Shipping Conditions:

  Dry ice.

• Storage Conditions:

  Stored at -80°C for 1 year

• Scientific Category:

  Recombinant Proteins