Products for Research Use Only
RegisterLogin

BID, Mouse (His)

CAT: 0804-HY-P701328-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P701328-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
BID Protein, a pro-apoptotic member of the Bcl-2 family, is initially discovered through binding to both pro-apoptotic Bax and anti-apoptotic Bcl-2. BID is activated in the BCL-2-regulated or mitochondrial apoptosis pathway and acts as a switch between the extrinsic and intrinsic cell death pathways. BID is susceptible to proteolytic cleavage by caspases, calpains, Granzyme B and cathepsins. BID Protein, Mouse (His) is the recombinant mouse-derived BID protein, expressed by E. coli , with C-His labeled tag.
Product Name Alternative
BID Protein, Mouse (His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/bid-protein-mouse-his.html
Purity
95.0
Smiles
AGSAWSYTACAMDSEVSNGSGLGAKHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFS
Molecular Formula
12122 (Gene_ID) EDK99650.1 (A1-S195) (Accession)
Molecular Weight
Approximately 22.72 kDa
References & Citations
[1]Billen LP, et al. Bid: a Bax-like BH3 protein. Oncogene. 2008 Dec;27 Suppl 1:S93-104.|[2]Yin XM. Bid, a BH3-only multi-functional molecule, is at the cross road of life and death. Gene. 2006 Mar 15;369:7-19.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P84410-01BID Antibody (YA4107, Mouse)
HY-P85054BID Antibody (YA4746, Mouse)
HY-P7662-01BID, Human
HY-P10614Bid BH3 peptide
HY-P5327R8 Bid BH3
HY-RS16655Bid Mouse Pre-designed siRNA Set A
HY-P11374Bid BH3-Gly-r8
HY-P5325Bid BH3 (80-99)
HY-P80031-01BID Antibody (YA583, Rabbit)
HY-P87892BID Antibody (YA7577, Rabbit)

Alternative Products

CatalogName
Z06033-100BID, His, Mouse
TMPK-00636-01BID Protein, Mouse, Recombinant (His)
GTR19136394-01Recombinant Mouse BID Protein, N-His
TMPY-02065-01BID Protein, Mouse, Recombinant (His & GST)
P522346BID Protein (N-GST & His, Mouse)
MOP1293-01Mouse BID Protein, His & GST Tag
E51P00099BID Protein, Mouse, Recombinant (C-His)
ARP8498-01Recombinant Mouse BID Protein (His & GST tag)
MBS8122699-01BID Protein, Mouse, Recombinant (His & GST Tag)
P500971BID Protein (N-His, Mus musculus (Mouse) )

Popular Products