CD1b Antibody

CAT:
800-RQ4547
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
CD1b Antibody - image 1

CD1b Antibody

  • Description :

    CD1b is a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail, and requires vesicular acidification to bind lipid antigens.
  • Specifications :

    Western blot: 0.5-1 µg/mL, IHC (FFPE) : 1-2 µg/mL
  • UniProt :

    P29016
  • Host :

    Rabbit
  • Reactivity :

    Human
  • Immunogen :

    Amino acids DKEVAELEEIFRVYIFGFAREVQDFAGDFQMKY were used as the immunogen for the CD1b antibody.
  • Clonality :

    Polyclonal
  • Isotype :

    IgG
  • Applications :

    WB, IHC-P
  • Purity :

    Antigen affinity purified
  • Format :

    Antigen affinity purified
  • Buffer :

    Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
  • Reconstitution :

    After reconstitution, the CD1b antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations :

    This CD1b antibody is available for research use only.
  • Storage Conditions :

    After reconstitution, the CD1b antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation :

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes :

    Optimal dilution of the CD1b antibody should be determined by the researcher.
  • CAS Number :

    9007-83-4
  • Location :

    Plasma membrane, cytoplasm
  • Image Legend :

    IHC staining of FFPE human tonsil tissue with CD1b antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide