CD18 Antibody

• Description:

  The beta-2 integrin chain gene is designated ITGB2 and the leukocyte antigen has been designated CD18. The 3 alpha integrin chains associated individually with the beta-2 chain as a heterodimer have gene designations of ITGAL, ITGAM, and ITGAX, and leukocyte antigen designations of CD11A, CD11B, and CD11C, respectively. The expression of CD18 was increased in lymphoblastoid cells from persons with Down syndrome, consistent with the location of the gene on chromosome 21. The ITGB2 gene spans approximately 40 kb and contains 16 exons and all exon/intron boundaries conform to the GT/AG splicing consensus. Furthermore, ITGB2 was constitutively clustered. Although it was expressed on the cell surface at normal levels and was capable of function following extracellular stimulation, it could not be activated via the “inside-out” signaling pathways.

• Specifications:

  Western blot: 0.5-1 µg/mL, IHC (FFPE) : 0.5-1 µg/mL

• UniProt:

  P05107

• Host:

  Rabbit

• Reactivity:

  Human

• Immunogen:

  An amino acid sequence from the N-terminus of human CD18 (ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD) was used as the immunogen for this CD18 antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB, IHC-P

• Purity:

  Antigen affinity

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide/thimerosal

• Reconstitution:

  After reconstitution, the CD18 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This CD18 antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the CD18 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  The stated application concentrations are suggested starting amounts. Titration of the CD18 antibody may be required due to differences in protocols and secondary/substrate sensitivity.

• CAS Number:

  9007-83-4

• Image Legend:

  Western blot testing of CD18 antibody and Lane 1: HeLa; 2: Jurkat; 3: HT1080; Predicted/Observed molecular weight: 85~95KD depending on glycosylation level.