LGALS3BP Antibody / Galectin-3-binding protein

• Description:

  Galectin-3-binding protein is a protein that in humans is encoded by the LGALS3BP gene. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV) . It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Using fluorescence in situ hybridization the full length 90K cDNA has been localized to chromosome 17q25. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1.

• Specifications:

  Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 1-2 µg/mL

• UniProt:

  Q08380

• Host:

  Rabbit

• Reactivity:

  Human, Mouse, Rat

• Immunogen:

  Amino acids HEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPR from the human protein were used as the immunogen for the LGALS3BP antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB, IHC-P

• Purity:

  Antigen affinity purified

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

• Reconstitution:

  After reconstitution, the LGALS3BP antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This LGALS3BP antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the LGALS3BP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Optimal dilution of the LGALS3BP antibody should be determined by the researcher.

• CAS Number:

  9007-83-4

• Image Legend:

  Western blot testing of human 1) HeLa, 2) COLO-320 and 3) mouse HEPA1-6 cell lysate with LGALS3BP antibody at 0.5ug/ml. Expected molecular weight: 65-90 kDa depending on glycosylation level.