ERBB4 Antibody

• Description :

  ERBB4 (V-erb-b2 avian erythroblastic leukemia viral oncogene homolog 4) also known as ONCOGENE ERBB4 or HER4, is an enzyme that in humans is encoded by the ERBB4 gene. The HER4/ERBB4 gene is a member of the type I receptor tyrosine kinase subfamily that includes EGFR, ERBB2 and ERBB3. This gene is mapped on 2q34. ERBB4 is a single-pass type I transmembrane protein with multiple furin-like cysteine rich domains, a tyrosine kinase domain, a phosphotidylinositol-3 kinase binding site and a PDZ domainbinding motif. Furthermore, ERBB4 is a transmembrane receptor tyrosine kinase that regulates cell proliferation and differentiation. After binding its ligand, heregulin, or activation of protein kinase C by TPA, the ERBB4 ectodomain is cleaved by a metalloprotease.

• CAS Number :

  9007-83-4

• Specifications :

  Western Blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 1-2 µg/mL

• UniProt :

  Q15303

• Host :

  Rabbit

• Reactivity :

  Human, Mouse, Rat

• Immunogen :

  Amino acids SLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLR from the human protein were used as the immunogen for the ERBB4 antibody.

• Clonality :

  Polyclonal

• Isotype :

  IgG

• Applications :

  WB, IHC-P

• Purity :

  Antigen affinity purified

• Format :

  Antigen affinity purified

• Buffer :

  Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

• Reconstitution :

  After reconstitution, the ERBB4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations :

  This ERBB4 antibody is available for research use only.

• Storage Conditions :

  After reconstitution, the ERBB4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation :

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes :

  Optimal dilution of the ERBB4 antibody should be determined by the researcher.

• Location :

  Cytoplasmic, nuclear

• Image Legend :

  IHC testing of FFPE human breast cancer tissue with ERBB4 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.