ERBB4 Antibody

CAT:
800-RQ4013
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
ERBB4 Antibody - image 1

ERBB4 Antibody

  • Description :

    ERBB4 (V-erb-b2 avian erythroblastic leukemia viral oncogene homolog 4) also known as ONCOGENE ERBB4 or HER4, is an enzyme that in humans is encoded by the ERBB4 gene. The HER4/ERBB4 gene is a member of the type I receptor tyrosine kinase subfamily that includes EGFR, ERBB2 and ERBB3. This gene is mapped on 2q34. ERBB4 is a single-pass type I transmembrane protein with multiple furin-like cysteine rich domains, a tyrosine kinase domain, a phosphotidylinositol-3 kinase binding site and a PDZ domainbinding motif. Furthermore, ERBB4 is a transmembrane receptor tyrosine kinase that regulates cell proliferation and differentiation. After binding its ligand, heregulin, or activation of protein kinase C by TPA, the ERBB4 ectodomain is cleaved by a metalloprotease.
  • CAS Number :

    9007-83-4
  • Specifications :

    Western Blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 1-2 µg/mL
  • UniProt :

    Q15303
  • Host :

    Rabbit
  • Reactivity :

    Human, Mouse, Rat
  • Immunogen :

    Amino acids SLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLR from the human protein were used as the immunogen for the ERBB4 antibody.
  • Clonality :

    Polyclonal
  • Isotype :

    IgG
  • Applications :

    WB, IHC-P
  • Purity :

    Antigen affinity purified
  • Format :

    Antigen affinity purified
  • Buffer :

    Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
  • Reconstitution :

    After reconstitution, the ERBB4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations :

    This ERBB4 antibody is available for research use only.
  • Storage Conditions :

    After reconstitution, the ERBB4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation :

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes :

    Optimal dilution of the ERBB4 antibody should be determined by the researcher.
  • Location :

    Cytoplasmic, nuclear
  • Image Legend :

    IHC testing of FFPE human breast cancer tissue with ERBB4 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide