CDC25C Antibody

• Description :

  M-phase inducer phosphatase 3is anenzymethat in humans is encoded by the CDC25C gene. This gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 (CDK1) and triggers entry into mitosis. Also, it is thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.

• CAS Number :

  9007-83-4

• Specifications :

  Western blot: 0.1-0.5 µg/mL

• UniProt :

  P30307

• Host :

  Rabbit

• Reactivity :

  Human

• Immunogen :

  Amino acids MHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP of human CDC25C were used as the immunogen for the CDC25C antibody.

• Clonality :

  Polyclonal

• Isotype :

  IgG

• Applications :

  WB

• Purity :

  Antigen affinity

• Format :

  Antigen affinity purified

• Buffer :

  Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

• Reconstitution :

  After reconstitution, the CDC25C antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations :

  This CDC25C antibody is available for research use only.

• Storage Conditions :

  After reconstitution, the CDC25C antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation :

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes :

  Optimal dilution of the CDC25C antibody should be determined by the researcher.

• Image Legend :

  Western blot testing of human 1) HeLa, 2) SW620 and 3) MCF7 lysate with CDC25C antibody. Expected molecular weight: ~53/60 kDa (unmodified/phosphorylated) .