CTACK/CCL27, Mouse

• Description :

  CTACK/CCL27 protein plays a crucial role in chemokine activity and cell chemotaxis. It regulates T cell chemotaxis and actin cytoskeletal reorganization, suggesting its involvement in immune responses and cell motility. CTACK/CCL27 Protein, Mouse is the recombinant mouse-derived CTACK/CCL27 protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  CTACK/CCL27 Protein, Mouse, Mouse, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/ctack-ccl27-protein-mouse.html

• Purity :

  98.00

• Smiles :

  LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSNPQQQN

• Molecular Formula :

  20301 (Gene_ID) NP_035466 (L26-N120) (Accession)

• Molecular Weight :

  Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins