MDC/CCL22, Mouse

• Description :

  CCL22/MDC Protein, Mouse is a CC chemokine that acts as a ligand for the CCR4 receptor and is a chemoattractant for CCR4-expressing cells such as Th2 cells, playing an important role in homeostatic and inflammatory responses. CCL22/MDC Protein, Mouse (His) is a recombinant mouse CCL22/MDC (G25-S92) protein expressed by E. coli.

• Product Name Alternative :

  MDC/CCL22 Protein, Mouse, Mouse, E. coli

• UNSPSC :

  12352202

• Purity :

  95.00

• Smiles :

  GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS

• Molecular Formula :

  20299 (Gene_ID) O88430 (G25-S92) (Accession)

• Molecular Weight :

  Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins