TECK/CCL25, Mouse

CAT:
804-HY-P71893-01
Size:
2 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
TECK/CCL25, Mouse - image 1

TECK/CCL25, Mouse

  • Description :

    The CCL25 protein emerged as a potential coordinator of T cell development, suggesting its involvement in the complex process of T cell maturation. Its recombinant form exhibits chemotactic activity against various immune cell types, including thymocytes and macrophages, by binding to the chemokine receptor CCR9. TECK/CCL25 Protein, Mouse is the recombinant mouse-derived TECK/CCL25 protein, expressed by E. coli , with tag free.
  • Product Name Alternative :

    TECK/CCL25 Protein, Mouse, Mouse, E. coli
  • UNSPSC :

    12352202
  • Purity :

    97.00
  • Smiles :

    QGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAIRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN
  • Molecular Formula :

    20300 (Gene_ID) O35903 (Q24-N144) (Accession)
  • Molecular Weight :

    Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions.
  • Shipping Conditions :

    Room temperature in continental US; may vary elsewhere.
  • Storage Conditions :

    Stored at -20°C for 2 years
  • Scientific Category :

    Recombinant Proteins

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide