Products for Research Use Only
RegisterLogin

MEC/CCL28, Mouse

CAT: 0804-HY-P7251-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7251-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
MEC/CCL28 Protein, Mouse is a CC chemokine that is present in almost all mucosal tissues and acts as a unifying immunostimulant on mucosal surfaces. CCL28 can bind to CCR3 and CCR10 to mediate immune responses, viral infections, cancer, and antimicrobial effects. MEC/CCL28 Protein, Mouse is a recombinant mouse MEC/CCL28 (S20-R130) protein expressed by E. coli[1][2].
Product Name Alternative
MEC/CCL28 Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mec-ccl28-protein-mouse.html
Purity
99.00
Smiles
SEAILPMASSCCTEVSHHVSGRLLERVSSCSIQRADGDCDLAAVILHVKRRRICISPHNRTLKQWMRASEVKKNGRENVCSGKKQPSRKDRKGHTTRKHRTRGTHRHEASR
Molecular Formula
56838 (Gene_ID) Q9JIL2 (S20-R130) (Accession)
Molecular Weight
Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Meurens F, et al. Expression of mucosal chemokines TECK/CCL25 and MEC/CCL28 during fetal development of the ovine mucosal immune system. Immunology. 2007 Apr;120 (4) :544-55.|[2]Hiroyuki Ogawa, et al. Regulated production of the chemokine CCL28 in human colon epithelium. Am J Physiol Gastrointest Liver Physiol. 2004 Nov;287 (5) :G1062-9.|[3]Teena Mohan, et al. CCL28 chemokine: An anchoring point bridging innate and adaptive immunity. Int Immunopharmacol. 2017 Oct;51:165-170.|[4]Nicolas Cuburu, et al. Sublingual immunization with nonreplicating antigens induces antibody-forming cells and cytotoxic T cells in the female genital tract mucosa and protects against genital papillomavirus infection. J Immunol. 2009 Dec 15;183 (12) :7851-9.|[5]Eleonora Castelletti, et al. The mucosae-associated epithelial chemokine (MEC/CCL28) modulates immunity in HIV infection. PLoS One. 2007 Oct 3;2 (10) :e969.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P7250-01MEC/CCL28, Human
HY-P7252-01MEC/CCL28, Rat
HY-P75447MEC/CCL28, Human (His)
HY-P11454-01PSM-mec peptide
HY-174754Human CCL28 mRNA
HY-RS17249Ccl28 Mouse Pre-designed siRNA Set A
HY-RS02098CCL28 Human Pre-designed siRNA Set A
HY-RS23703Ccl28 Rat Pre-designed siRNA Set A
HY-P79264-01CTACK/CCL27, Mouse
HY-P71893-01TECK/CCL25, Mouse

Alternative Products

CatalogName
QY-E21773Mouse CCL28 / MEC
MBS691563-01Mouse MEC (CCL28)
JOT-PR2007Recombinant Mouse MEC/CCL28 (rMuMEC/CCL28)
GTR18991563-01Recombinant Mouse MEC/CCL28 (rMuMEC/CCL28)
RC335-39MEC, CCL28, murine (mouse)
Z200339Recombinant Mouse MEC (CCL28)
MBS553284Mouse MEC (CCL28) Recombinant
CD00303Recombinant Mouse MEC/CCL28 protein
E55A03996Mouse CCL28/MEC Polyclonal Antibody
PPT-16302Mouse CCL28/MEC Recombinant Protein

Popular Products