MEC/CCL28, Mouse

CAT:
804-HY-P7251-01
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
MEC/CCL28, Mouse - image 1

MEC/CCL28, Mouse

  • Description :

    MEC/CCL28 Protein, Mouse is a CC chemokine that is present in almost all mucosal tissues and acts as a unifying immunostimulant on mucosal surfaces. CCL28 can bind to CCR3 and CCR10 to mediate immune responses, viral infections, cancer, and antimicrobial effects. MEC/CCL28 Protein, Mouse is a recombinant mouse MEC/CCL28 (S20-R130) protein expressed by E. coli[1][2].
  • Product Name Alternative :

    MEC/CCL28 Protein, Mouse, Mouse, E. coli
  • UNSPSC :

    12352202
  • Type :

    Recombinant Proteins
  • Assay Protocol :

    https://www.medchemexpress.com/cytokines/mec-ccl28-protein-mouse.html
  • Purity :

    99.00
  • Smiles :

    SEAILPMASSCCTEVSHHVSGRLLERVSSCSIQRADGDCDLAAVILHVKRRRICISPHNRTLKQWMRASEVKKNGRENVCSGKKQPSRKDRKGHTTRKHRTRGTHRHEASR
  • Molecular Formula :

    56838 (Gene_ID) Q9JIL2 (S20-R130) (Accession)
  • Molecular Weight :

    Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.
  • References & Citations :

    [1]Meurens F, et al. Expression of mucosal chemokines TECK/CCL25 and MEC/CCL28 during fetal development of the ovine mucosal immune system. Immunology. 2007 Apr;120 (4) :544-55.|[2]Hiroyuki Ogawa, et al. Regulated production of the chemokine CCL28 in human colon epithelium. Am J Physiol Gastrointest Liver Physiol. 2004 Nov;287 (5) :G1062-9.|[3]Teena Mohan, et al. CCL28 chemokine: An anchoring point bridging innate and adaptive immunity. Int Immunopharmacol. 2017 Oct;51:165-170.|[4]Nicolas Cuburu, et al. Sublingual immunization with nonreplicating antigens induces antibody-forming cells and cytotoxic T cells in the female genital tract mucosa and protects against genital papillomavirus infection. J Immunol. 2009 Dec 15;183 (12) :7851-9.|[5]Eleonora Castelletti, et al. The mucosae-associated epithelial chemokine (MEC/CCL28) modulates immunity in HIV infection. PLoS One. 2007 Oct 3;2 (10) :e969.
  • Shipping Conditions :

    Room temperature in continental US; may vary elsewhere.
  • Storage Conditions :

    Stored at -20°C for 2 years
  • Scientific Category :

    Recombinant Proteins

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide