CDC42, Human (GST)

• UNSPSC Description :

  CDC42 is a plasma membrane-associated small GTPase that regulates cellular responses by cycling between an active GTP-bound state and an inactive GDP-bound state. It participates in epithelial cell polarization, regulates the attachment of spindle microtubules to kinetochores, affects cell migration, and plays a key role in the formation of filopodia. CDC42 Protein, Human (GST) is the recombinant human-derived CDC42 protein, expressed by E. coli , with N-GST labeled tag. The total length of CDC42 Protein, Human (GST) is 188 a.a., with molecular weight of ~44 kDa.

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/cdc42-protein-human-gst.html

• Purity :

  97.00

• Smiles :

  MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRC

• Molecular Weight :

  Approximately 44 kDa

• Shipping Conditions :

  Blue Ice

• Storage Conditions :

  Stored at -20°C for 2 years