Products for Research Use Only
RegisterLogin

CDC42, Human (Active, GST-His)

CAT: 0804-HY-P704540Size: 1 EachDry Ice: YesHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P704540Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
CDC42 is a plasma membrane-associated small GTPase that regulates cellular responses by cycling between an active GTP-bound state and an inactive GDP-bound state. It participates in epithelial cell polarization, regulates the attachment of spindle microtubules to kinetochores, affects cell migration, and plays a key role in the formation of filopodia. CDC42 Protein, Human (Active, GST-His) is the recombinant human-derived CDC42 protein, expressed by E. coli, with N-His and N-GST labeled tag.
Product Name Alternative
CDC42 Protein, Human (Active, GST-His), Human, E. coli
UNSPSC
12352202
Smiles
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
Molecular Formula
998 (Gene_ID) P60953-2 (M1-L191) (Accession)
Molecular Weight
Approximately 48 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P74258-01CDC42, Human (GST)
HY-P705578CLK3, Human (Active, sf9, His-GST)
HY-P703411MYLK4, Human (Active, sf9, His, GST)
HY-P702921BRAF, Human (Active, sf9, GST, His)
HY-P703273USP52, Human (Active, sf9, His, GST)
HY-P705566PRKCB2, Human (Active, sf9, His-GST)
HY-P703483SBK2, Human (Active, sf9, His, GST)
HY-P703323MYO3A, Human (Active, sf9, His, GST, Strep)
HY-P703581-01PK3CD/p85, Human (Active, sf9, His, Strep, GST)
HY-P705569FGFR-4, Human (V550L, Active, sf9, His-GST)

Alternative Products

CatalogName
P523133CDC42 Protein (N-GST-His, Human)
C6101-ACdc42 protein - His tagged - human constitutively active
KND30197Cdc42, gst tagged human
P97019PTac-GST-CDC42 (human)
TMPY-02308-01CDC42 Protein, Human, Recombinant (GST)
KMPH1175-01Human CDC42 Protein, GST Tag
P523134CDC42 Protein (N-GST, Human)
GWB-PSA8B0PDE3A (His-GST), Active Human Recombinant Protein
550734Cdc42, Recombinant, Human, GST-Tag discontinued
PH52612E6CDC42 Protein, Human, Recombinant (GST Tag)

Popular Products