Products for Research Use Only
RegisterLogin

DDX39B, Human (GST)

CAT: 0804-HY-P71534Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P71534Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
The DDX39B protein intricately coordinates nuclear mRNA export and is specifically associated with spliced mRNA as a key component of the TREX complex. This coupling of mRNA transcription, processing, and export involves rounds of ATP-dependent hydrolysis, recruiting components such as ALYREF/THOC and CHTOP. DDX39B Protein, Human (GST) is the recombinant human-derived DDX39B protein, expressed by E. coli , with N-GST labeled tag.
Product Name Alternative
DDX39B Protein, Human (GST), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ddx39b-protein-human-gst.html
Smiles
AENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFV
Molecular Formula
7919 (Gene_ID) Q13838 (A2-V251) (Accession)
Molecular Weight
Approximately 55.2 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-RS03645DDX39B Human Pre-designed siRNA Set A
HY-P82725-01DDX39B Antibody (YA2470, Rabbit)
HY-RS27052Ddx39b Rat Pre-designed siRNA Set A
HY-RS20544Ddx39b Mouse Pre-designed siRNA Set A
HY-P71401-01UBE2G2, Human (GST)
HY-P701932ADH6, Human (GST)
HY-P705432IL1B, Human (GST)
HY-P704096VAV1, Human (GST)
HY-P704074CHMP1B, Human (GST)
HY-P71683RPS13, Human (GST)

Alternative Products

CatalogName
TMPH-02133-01DDX39B Protein, Human, Recombinant (GST)
373014-01DDX39B, Recombinant, Human, aa2-251, GST-Tag (Spliceosome RNA Helicase DDX39B)
586393-01Spliceosome RNA Helicase DDX39B, Recombinant, Human, aa2-251, GST-Tag
QP8315-ec-1mgRecombinant Human Spliceosome RNA helicase DDX39B Protein, GST, E.coli-1mg
QP8315-ec-50ugRecombinant Human Spliceosome RNA helicase DDX39B Protein, GST, E.coli-50ug
QP8315-ec-10ugRecombinant Human Spliceosome RNA helicase DDX39B Protein, GST, E.coli-10ug
QP8315-ec-200ugRecombinant Human Spliceosome RNA helicase DDX39B Protein, GST, E.coli-200ug
QP8315-ec-500ugRecombinant Human Spliceosome RNA helicase DDX39B Protein, GST, E.coli-500ug
QP8315-ec-100ugRecombinant Human Spliceosome RNA helicase DDX39B Protein, GST, E.coli-100ug
CSB-RP003044h-01Human Spliceosome RNA helicase DDX39B (DDX39B)

Popular Products