Products for Research Use Only
RegisterLogin

CALML3, Human (GST)

CAT: 0804-HY-P72110Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P72110Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
The CALML3 protein has a dual role, acting as a specific light chain of unconventional myosin 10 (MYO10) and enhancing MYO10 translation. CALML3 has a potential molecular chaperone role and contributes to the synthesis of the emerging MYO10 heavy chain protein. CALML3 Protein, Human (GST) is the recombinant human-derived CALML3 protein, expressed by E. coli , with N-GST labeled tag.
Product Name Alternative
CALML3 Protein, Human (GST), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/calml3-protein-human-gst.html
Smiles
MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
Molecular Formula
810 (Gene_ID) P27482 (M1-K149) (Accession)
Molecular Weight
Approximately 43.9 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-RS01843CALML3 Human Pre-designed siRNA Set A
HY-RS26263Calml3 Rat Pre-designed siRNA Set A
HY-RS19766Calml3 Mouse Pre-designed siRNA Set A
HY-P71401-01UBE2G2, Human (GST)
HY-P701932ADH6, Human (GST)
HY-P705432IL1B, Human (GST)
HY-P704096VAV1, Human (GST)
HY-P704074CHMP1B, Human (GST)
HY-P71683RPS13, Human (GST)
HY-P701927ADH4, Human (GST)

Alternative Products

CatalogName
QP5748-ec-50ugRecombinant Human CALML3 Protein, GST, E.coli-50ug
QP5748-ec-1mgRecombinant Human CALML3 Protein, GST, E.coli-1mg
QP5748-ec-10ugRecombinant Human CALML3 Protein, GST, E.coli-10ug
QP5748-ec-100ugRecombinant Human CALML3 Protein, GST, E.coli-100ug
QP5748-ec-500ugRecombinant Human CALML3 Protein, GST, E.coli-500ug
QP5748-ec-200ugRecombinant Human CALML3 Protein, GST, E.coli-200ug
372544-01CALML3, Recombinant, Human, aa1-149, GST-Tag (Calmodulin-like Protein 3, CaM-like Protein)
PT-A00642-01CALML3 Human
MBS8202808-01CALML3 siRNA (Human)
abx900754-01Human CALML3 siRNA

Popular Products