Recombinant Human Double-stranded RNA-specific adenosine deaminase (ADAR), partial

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
V5319-100UG	dsDNA Recombinant Antibody / Double Stranded DNA
V5319-20UG	dsDNA Recombinant Antibody / Double Stranded DNA
V5319SAF-100UG	dsDNA Recombinant Antibody / Double Stranded DNA
V5321-20UG	dsDNA Recombinant Antibody / Double Stranded DNA
V5321SAF-100UG	dsDNA Recombinant Antibody / Double Stranded DNA
V8122-20UG	dsDNA Recombinant Antibody / Double Stranded DNA
V8639-100UG	dsDNA Recombinant Antibody / Double Stranded DNA
V8639SAF-100UG	dsDNA Recombinant Antibody / Double Stranded DNA
GWB-530005	Double Stranded DNA (dsDNA)
E01A0440-01	Human DNA (Double Stranded) ELISA Kit

CAT:

399-CSB-EP001324HU2-01

Size:

1 mg

Price:

Ask

For price, please contact [email protected].

Recombinant Human Double-stranded RNA-specific adenosine deaminase (ADAR), partial

Gene Name: ADAR
UniProt: P55265
Expression Region: 122-199aa
Organism: Homo sapiens
Target Sequence: GVDCLSSHFQELSIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAV
Tag: N-terminal GST-tagged
Source: E.coli
Field of Research: Transcription
Assay Type: In Stock Protein
Relevance: Catalyzes the hydrolytic deamination of adenosine to inosine in double-stranded RNA (dsRNA) referred to as A-to-I RNA editing. This may affect gene expression and function in a number of ways that include mRNA translation by changing codons and hence the amino acid sequence of proteins since the translational machinery read the inosine as a guanosine; pre-mRNA splicing by altering splice site recognition sequences; RNA stability by changing sequences involved in nuclease recognition; genetic stability in the case of RNA virus genomes by changing sequences during viral RNA replication; and RNA structure-dependent activities such as microRNA production or targeting or protein-RNA interactions. Can edit both viral and cellular RNAs and can edit RNAs at multiple sites (hyper-editing) or at specific sites (site-specific editing). Its cellular RNA substrates include: bladder cancer-associated protein (BLCAP), neurotransmitter receptors for glutamate (GRIA2) and serotonin (HTR2C) and GABA receptor (GABRA3). Site-specific RNA editing of transcripts encoding these proteins results in amino acid substitutions which consequently alters their functional activities. Exhibits low-level editing at the GRIA2 Q/R site, but edits efficiently at the R/G site and HOTSPOT1. Its viral RNA substrates include: hepatitis C virus (HCV), vesicular stomatitis virus (VSV), measles virus (MV), hepatitis delta virus (HDV), and human immunodeficiency virus type 1 (HIV-1). Exhibits either a proviral (HDV, MV, VSV and HIV-1) or an antiviral effect (HCV) and this can be editing-dependent (HDV and HCV), editing-independent (VSV and MV) or both (HIV-1). Impairs HCV replication via RNA editing at multiple sites. Enhances the replication of MV, VSV and HIV-1 through an editing-independent mechanism via suppression of EIF2AK2/PKR activation and function. Stimulates both the release and infectivity of HIV-1 viral particles by an editing-dependent mechanism where it associates with viral RNAs and edits adenosines in the 5'UTR and the Rev and Tat coding sequence. Can enhance viral replication of HDV via A-to-I editing at a site designated as amber/W, thereby changing an UAG amber stop codon to an UIG tryptophan (W) codon that permits synthesis of the large delta antigen (L-HDAg) which has a key role in the assembly of viral particles. However, high levels of ADAR1 inhibit HDV replication.
Purity: Greater than 85% as determined by SDS-PAGE.
Activity: Not Test
Length: Partial
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 35.0 kDa
References & Citations: Molecular cloning of cDNA for double-stranded RNA adenosine deaminase, a candidate enzyme for nuclear RNA editing.Kim U., Wang Y., Sanford T., Zeng Y., Nishikura K.Proc. Natl. Acad. Sci. U.S.A. 91:11457-11461 (1994)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Human Double-stranded RNA-specific adenosine deaminase (ADAR), partial, falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Cat

Name

CSB-EP001324HUa0-03

Recombinant Human Double-stranded RNA-specific adenosine deaminase (ADAR), partial

CSB-EP001324HU2-02

Recombinant Human Double-stranded RNA-specific adenosine deaminase (ADAR), partial

CSB-EP001324HU2-01

Recombinant Human Double-stranded RNA-specific adenosine deaminase (ADAR), partial

CSB-EP001324HU-01

Recombinant Human Double-stranded RNA-specific adenosine deaminase (ADAR), partial

CSB-EP001324HU-02

Recombinant Human Double-stranded RNA-specific adenosine deaminase (ADAR), partial

CSB-EP001324HU2-03

Recombinant Human Double-stranded RNA-specific adenosine deaminase (ADAR), partial

CSB-MP001324HU-03

Recombinant Human Double-stranded RNA-specific adenosine deaminase (ADAR), partial

CSB-EP001324HUe0-03

Recombinant Human Double-stranded RNA-specific adenosine deaminase (ADAR), partial

CSB-MP001324HU-02

Recombinant Human Double-stranded RNA-specific adenosine deaminase (ADAR), partial

CSB-EP001324HUa0-02

Recombinant Human Double-stranded RNA-specific adenosine deaminase (ADAR), partial

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on