Products for Research Use Only

MDC/CCL22, Rat

CAT: 0804-HY-P7249-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7249-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
CCL22/MDC Protein, Rat is a CC chemokine that acts as a ligand for the CCR4 receptor and is a chemoattractant for CCR4-expressing cells such as Th2 cells, playing an important role in homeostatic and inflammatory responses. CCL22/MDC Protein, Rat is a recombinant rat CCL22/MDC (G25-A92) protein expressed by E. coli[1][2].
Product Name Alternative
MDC/CCL22 Protein, Rat, Rat, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mdc-ccl22-protein-rat.html
Purity
95.00
Smiles
GPYGANVEDSICCQDYIRHPLPPRFVKEFYWTSKSCRKPGVVLITIKNRDICADPRMLWVKKILHKLA
Molecular Formula
117551 (Gene_ID) Q5I0L5 (G25-A92) (Accession)
Molecular Weight
Approximately 10 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Yano C, et al. Mechanism of Macrophage-Derived Chemokine/CCL22 Production by HaCaT Keratinocytes. Ann Dermatol. 2015 Apr;27 (2) :152-6.|[2]Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21 (21) :8412.|[3]Stefanie Scheu, et al. The C-C Chemokines CCL17 and CCL22 and Their Receptor CCR4 in CNS Autoimmunity. Int J Mol Sci. 2017 Nov 2;18 (11) :2306.|[4]T Inoue, et al. CCL22 and CCL17 in rat radiation pneumonitis and in human idiopathic pulmonary fibrosis. Eur Respir J. 2004 Jul;24 (1) :49-56.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Popular Products