MDC/CCL22, Rat

• Description:

  CCL22/MDC Protein, Rat is a CC chemokine that acts as a ligand for the CCR4 receptor and is a chemoattractant for CCR4-expressing cells such as Th2 cells, playing an important role in homeostatic and inflammatory responses. CCL22/MDC Protein, Rat is a recombinant rat CCL22/MDC (G25-A92) protein expressed by E. coli[1][2].

• Product Name Alternative:

  MDC/CCL22 Protein, Rat, Rat, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/mdc-ccl22-protein-rat.html

• Purity:

  95.00

• Smiles:

  GPYGANVEDSICCQDYIRHPLPPRFVKEFYWTSKSCRKPGVVLITIKNRDICADPRMLWVKKILHKLA

• Molecular Formula:

  117551 (Gene_ID) Q5I0L5 (G25-A92) (Accession)

• Molecular Weight:

  Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations:

  [1]Yano C, et al. Mechanism of Macrophage-Derived Chemokine/CCL22 Production by HaCaT Keratinocytes. Ann Dermatol. 2015 Apr;27 (2) :152-6.|[2]Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21 (21) :8412.|[3]Stefanie Scheu, et al. The C-C Chemokines CCL17 and CCL22 and Their Receptor CCR4 in CNS Autoimmunity. Int J Mol Sci. 2017 Nov 2;18 (11) :2306.|[4]T Inoue, et al. CCL22 and CCL17 in rat radiation pneumonitis and in human idiopathic pulmonary fibrosis. Eur Respir J. 2004 Jul;24 (1) :49-56.

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions:

  Stored at -20°C for 2 years

• Scientific Category:

  Recombinant Proteins