Products for Research Use Only
RegisterLogin

MDC/CCL22, Mouse (His, solution)

CAT: 0804-HY-P7248-01Size: 10 µgDry Ice: YesHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7248-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
CCL22/MDC Protein, Mouse (His) is a CC chemokine that acts as a ligand for the CCR4 receptor and is a chemoattractant for CCR4-expressing cells such as Th2 cells, playing an important role in homeostatic and inflammatory responses. CCL22/MDC Protein, Mouse (His) is a recombinant mouse CCL22/MDC (G25-S92) protein expressed by E. coli with a his tag[1][2].
Product Name Alternative
MDC/CCL22 Protein, Mouse (His, solution), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mdc-ccl22-protein-mouse.html
Purity
98.0
Smiles
GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS
Molecular Formula
20299 (Gene_ID) O88430 (G25-S92) (Accession)
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Yano C, et al. Mechanism of Macrophage-Derived Chemokine/CCL22 Production by HaCaT Keratinocytes. Ann Dermatol. 2015 Apr;27 (2) :152-6.|[2]Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21 (21) :8412.|[3]Stefanie Scheu, et al. The C-C Chemokines CCL17 and CCL22 and Their Receptor CCR4 in CNS Autoimmunity. Int J Mol Sci. 2017 Nov 2;18 (11) :2306.|[4]Vanessa Pinho, et al. The role of CCL22 (MDC) for the recruitment of eosinophils during allergic pleurisy in mice. J Leukoc Biol. 2003 Mar;73 (3) :356-62.|[5]Jillian R Richter, et al. Macrophage-derived chemokine (CCL22) is a novel mediator of lung inflammation following hemorrhage and resuscitation. Shock. 2014 Dec;42 (6) :525-31.
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P7248A-01MDC/CCL22, Mouse
HY-P7249-01MDC/CCL22, Rat
HY-P72790-01MDC/CCL22, Human
HY-P704783-01MDC/CCL22, Human (HEK293, Fc)
HY-P76119A-01UCHL3, Mouse (His, solution)
HY-P76583-01S100A13, Mouse (His, solution)
HY-P7S0323Eef1a1, Mouse (His, solution)
HY-P73916-01HSP60, Mouse (His, solution)
HY-P71189-01PCSK9, Mouse (HEK293, His, solution)
HY-P72989-01EGFR, Mouse (HEK293, His, solution)

Alternative Products

CatalogName
TMPY-00305-01MDC/CCL22 Protein, Mouse, Recombinant (His)
P522649CCL22 Protein (N-His, Mouse)
MBS8123162-01MDC Protein, Mouse, Recombinant (His Tag)
ARO-P10448-01Recombinant Mouse CCL22 Protein, N-His-SUMO
PV162758CCL22 Protein Vector (Mouse) (pPB-C-His)
PV162759CCL22 Protein Vector (Mouse) (pPB-N-His)
PV162761CCL22 Protein Vector (Mouse) (pPM-C-His)
MT358022-01Mouse CCL22 Recombinant Protein (N-GST & C-His)
P501326CCL22 Protein (N-His-SUMO, Mus musculus (Mouse) )
MBS692094-01Mouse MDC (CCL22)

Popular Products