Products for Research Use Only
RegisterLogin

CCL24/Eotaxin-2, Human

CAT: 0804-HY-P7161-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7161-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
CCL24/Eotaxin-2 Protein, Human is a CC chemokine that interacts with the chemokine receptor CCR3 to induce eosinophil chemotaxis and mediate atopic diseases, parasitic infections and systemic diseases, as well as promote cellular transport and regulate inflammatory and fibrotic activities. CCL24/Eotaxin-2 Protein, Human is a recombinant human CCL24/Eotaxin-2 (V27-A104) protein expressed by E. coli[1].
Product Name Alternative
CCL24/Eotaxin-2 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ccl24-eotaxin-2-protein-human.html
Purity
98.0
Smiles
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVA
Molecular Formula
6369 (Gene_ID) O00175 (V27-A104) (Accession)
Molecular Weight
Approximately 9 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Hui Li, et al. Trophoblasts-derived chemokine CCL24 promotes the proliferation, growth and apoptosis of decidual stromal cells in human early pregnancy. Int J Clin Exp Pathol. 2013 May 15;6 (6) :1028-37.|[2]Michal Segal-Salto, et al. A blocking monoclonal antibody to CCL24 alleviates liver fibrosis and inflammation in experimental models of liver damage. JHEP Rep. 2020 Jan 2;2 (1) :100064.|[3]Andrew Menzies-Gow, et al. Eotaxin (CCL11) and eotaxin-2 (CCL24) induce recruitment of eosinophils, basophils, neutrophils, and macrophages as well as features of early- and late-phase allergic reactions following cutaneous injection in human atopic and nonatopic volunteers. J Immunol. 2002 Sep 1;169 (5) :2712-8.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P7760-01CCL24/Eotaxin-2, Mouse
HY-P700009-01CCL24/Eotaxin-2, Rat
HY-P7162Eotaxin-2/CCL24, Rat
HY-P7S0112CCL24/Eotaxin-2, Rat (93aa, His)
HY-P700964-01CCL24/Eotaxin-2, Cynomolgus (HEK293, His)
HY-P78250-01CCL24/Eotaxin-2, Mouse (HEK293, Fc)
HY-P78248-01CCL24/Eotaxin-2, Mouse (HEK293, His)
HY-P7163-01Eotaxin-3/CCL26, Human
HY-P75606Eotaxin-3/CCL26, Human (sf9)
HY-174758Human CCL24 mRNA

Alternative Products

CatalogName
MBS691732-01Human Eotaxin-2 (CCL24)
HECCP-2401Recombinant Human Eotaxin-2/CCL24(CCL24)
RC315-35Eotaxin-2, CCL24, human
PT_40107-01Eotaxin-2 Human Recombinant (CCL24) (Eotaxin 2 Human)
4497-1000Eotaxin-2/CCL24, human recombinant
P6668-100μgRecombinant Human Eotaxin-2/CCL24
MBS550663-01Anti-Human Eotaxin-2 (CCL24)
Z100185Recombinant Human Eotaxin-2 (CCL24)
360180-01Eotaxin-2, Recombinant, Human (CCL24)
90128-BHuman Eotaxin-2 (CCL24) Recombinant

Popular Products