Products for Research Use Only
RegisterLogin

Eotaxin-3/CCL26, Human

CAT: 0804-HY-P7163-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7163-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Eotaxin-3/CCL26 Protein, Human is a CC chemokine that binds to chemokine receptors CCR3 or CX3CR1 and is a chemotactic agent for eosinophils and basophils that mediates inflammatory responses. Eotaxin-3/CCL26 Protein, Human is a recombinant human Eotaxin-3/CCL26 (T24-L94) protein expressed by E. coli[1].
Product Name Alternative
Eotaxin-3/CCL26 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/eotaxin-3-ccl26-protein-human.html
Purity
95.0
Smiles
TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
Molecular Formula
10344 (Gene_ID) Q9Y258 (T24-L94) (Accession)
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Banwell ME, et al. Regulation of human eotaxin-3/CCL26 expression: modulation by cytokines and glucocorticoids. Cytokine. 2002 Mar 21;17 (6) :317-23.|[2]Larose MC, et al. Correlation between CCL26 production by human bronchial epithelial cells and airway eosinophils: Involvement in patients with severe eosinophilic asthma. J Allergy Clin Immunol. 2015 Oct;136 (4) :904-13.|[3]Marie-Chantal Larose, et al. Correlation between CCL26 production by human bronchial epithelial cells and airway eosinophils: Involvement in patients with severe eosinophilic asthma. J Allergy Clin Immunol. 2015 Oct;136 (4) :904-13.|[4]Véronique Provost, et al. CCL26/eotaxin-3 is more effective to induce the migration of eosinophils of asthmatics than CCL11/eotaxin-1 and CCL24/eotaxin-2. J Leukoc Biol. 2013 Aug;94 (2) :213-22.|[5]Takashi Nakayama, et al. Eotaxin-3/CC chemokine ligand 26 is a functional ligand for CX3CR1. J Immunol. 2010 Dec 1;185 (11) :6472-9.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P7161-01CCL24/Eotaxin-2, Human
HY-174756Human CCL26 mRNA
HY-P7760-01CCL24/Eotaxin-2, Mouse
HY-P7766-01CCL24/Eotaxin-2, Human (HEK293, His)
HY-P700009-01CCL24/Eotaxin-2, Rat
HY-P7162Eotaxin-2/CCL24, Rat
HY-P7159-01Eotaxin/CCL11, Human
HY-P700963Eotaxin/CCL11, Human (His)
HY-P7S0112CCL24/Eotaxin-2, Rat (93aa, His)
HY-P700964-01CCL24/Eotaxin-2, Cynomolgus (HEK293, His)

Alternative Products

CatalogName
YP-W11306-01Human Eotaxin-3; CCL26 (Eotaxin-3; CCL26) ELISA Kit
RC315-37Eotaxin-3, CCL26, human
MBS691877-01Human Eotaxin-3 (CCL26)
PT_40497-01Eotaxin-3 Human Recombinant (CCL26) (Eotaxin 3 Human)
JOT-PR1018Recombinant Human Eotaxin-3/CCL26 (rHuEotaxin-3/CCL26)
GTR18991616-01Recombinant Human Eotaxin-3/CCL26 (rHuEotaxin-3/CCL26)
P1222-.1Recombinant Human Eotaxin-3/CCL26
653-E3-025Recombinant Human CCL26/Eotaxin-3
MBS4159775-01Recombinant Human Eotaxin-3 (CCL26)
P514908Eotaxin-3; CCL26 Protein (Human)

Popular Products