Products for Research Use Only

CCL24/Eotaxin-2, Mouse

CAT: 0804-HY-P7760-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7760-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
CCL24/Eotaxin-2 Protein, Mouse is a CC chemokine that interacts with the chemokine receptor CCR3 to induce eosinophil chemotaxis and mediate atopic diseases, parasitic infections and systemic diseases, as well as promote cellular transport and regulate inflammatory and fibrotic activities. CCL24/Eotaxin-2 Protein, Mouse is a recombinant mouse CCL24/Eotaxin-2 (V27-V119) protein expressed by E. coli[1].
Product Name Alternative
CCL24/Eotaxin-2 Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ccl24-eotaxin-2-protein-mouse.html
Purity
95.0
Smiles
VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV
Molecular Formula
56221 (Gene_ID) Q9JKC0 (V27-V119) (Accession)
Molecular Weight
Approximately 12 kDa
References & Citations
[1] Amanda K Huber, et al. An emerging role for eotaxins in neurodegenerative disease. Clin Immunol. 2018 Apr;189:29-33.|[2]Adi Mor. et al. Blockade of CCL24 with a monoclonal antibody ameliorates experimental dermal and pulmonary fibrosis. Ann Rheum Dis. 2019 Sep;78 (9) :1260-1268.|[3]Hui Li, et al. Trophoblasts-derived chemokine CCL24 promotes the proliferation, growth and apoptosis of decidual stromal cells in human early pregnancy. Int J Clin Exp Pathol. 2013 May 15;6 (6) :1028-37.|[4]Michal Segal-Salto, et al. A blocking monoclonal antibody to CCL24 alleviates liver fibrosis and inflammation in experimental models of liver damage. JHEP Rep. 2020 Jan 2;2 (1) :100064.|[5]Adi Mor, et al. Blockade of CCL24 with a monoclonal antibody ameliorates experimental dermal and pulmonary fibrosis. Ann Rheum Dis. 2019 Sep;78 (9) :1260-1268.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins