FGF-12, Human

• Description:

  FGF-12, vital for nervous system development, positively regulates voltage-gated sodium channels, particularly SCN8A, enhancing neuronal excitability. It achieves this by elevating the voltage dependence of SCN8A fast inactivation. FGF-12 interacts specifically with the C-terminal region of SCN9A. FGF-12 Protein, Human is the recombinant human-derived FGF-12 protein, expressed by E. coli , with tag free.

• Product Name Alternative:

  FGF-12 Protein, Human, Human, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/fgf-12-protein-human.html

• Purity:

  95.0

• Smiles:

  MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

• Molecular Formula:

  2257 (Gene_ID) P61328-2 (M1-T181) (Accession)

• Molecular Weight:

  Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions:

  Stored at -20°C for 2 years

• Scientific Category:

  Recombinant Proteins