Transferrin Antibody / TF

• Description:

  Transferrins are iron-binding blood plasma glycoproteins that control the level of free iron in biological fluids. In humans, it is encoded by the TF gene. Transferrin consists of a polypeptide chain containing 679 amino acids in humans. The protein is composed of alpha helices and beta sheets to form two domains. The N- and C- terminal sequences are represented by globular lobes and between the two lobes is an iron-binding site. Transferrin is a glycoprotein that binds iron very tightly but reversibly. Although iron bound to transferrin is less than 0.1% (4 mg) of the total body iron, it is the most important iron pool, with the highest rate of turnover (25 mg/24 h) . And Transferrin has a molecular weight of around 80 kDa and contains 2 specific high-affinity Fe (III) binding sites. The affinity of transferrin for Fe (III) is extremely high (1023 M?1 at pH 7.4) but decreases progressively with decreasing pH below neutrality.

• Specifications:

  Western blot: 0.5-1 µg/mL

• UniProt:

  P02787

• Host:

  Mouse

• Reactivity:

  Human, Mouse, Rat

• Immunogen:

  Amino acids 20-49 (VPDKTVRWCAVSEHEATKCQSFRDHMKSVI) from the human protein were used as the immunogen for the Transferrin antibody.

• Clonality:

  Monoclonal

• Isotype:

  IgG2b

• Clone:

  7I11B10

• Applications:

  WB

• Purity:

  Antigen affinity purified

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2% Trehalose

• Reconstitution:

  After reconstitution, the Transferrin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This Transferrin antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the Transferrin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Optimal dilution of the Transferrin antibody should be determined by the researcher.

• CAS Number:

  9007-83-4

• Image Legend:

  Western blot testing of 1) human HCCP, 2) rat liver and 3) mouse liver tissue lysate with Transferrin antibody. Predicted molecular weight ~77 kDa.