Products for Research Use Only
RegisterLogin

RecombinantIL-2Rα, His, Human

CAT: 0384-BK0314-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0384-BK0314-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Interleukin-2 receptor (IL-2R) is a heterotrimeric protein expressed on the surface of certain immune cells, such as lymphocytes, that binds and responds to the cytokine IL-2. The IL-2R is made up of 3 subunits - alpha (α), beta (β) and gamma (γ) . The α and β chains are involved in binding IL-2, while signal transduction following cytokine interaction is carried out by the γ-chain, along with the β subunit. The β and γ chains of the IL-2R are members of the type I cytokine receptor family. IL-2R has a high binding affinity to IL-2 and is expressed by antigen-activated T lymphocytes (T cells) . IL-2 Rα is also known as CD25, p55, and Tac (activated T cell) antigen.Recombinant Human Interleukin-2 Receptor α (IL-2 R α), His produced in HEK 293 cells is a polypeptide chain containing 205 amino acids. A fully biologically active molecule, rhIL-2 R α has a molecular mass of 42 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE and HPLC.
Bioactivity
Determined by its ability to increase the proliferation effect of IL-2 in murine CTLL-2 cells. In the presence of 1 ng/ml of recombinant IL-2, ED50 for this effect is < 1.5 µg/ml.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
42 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Human Interleukin-2 Receptor α remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-2 Receptor α should be stable up to 1 week at 4°C or up to 3 months at -20°C.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
HEK 293
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
HHHHHHHHELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQ KERKTTEMQSPMQPVDQASLPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQ LICTGEMETSQFPGEEKPQASPEGRPESETSC

Related Products

CatalogName
BK0234-01RecombinantIL-17A, His, Human
BK0090-01RecombinantIL-15, His, Human
BK0242-01RecombinantIL-3, His, Rat
BK0257-01RecombinantIL-7, His, Rat
BK0256-01RecombinantIL-7, His, Mouse
BK0229-01RecombinantIL-12, His, Rat
BK0255RecombinantIL-7, His, Human (CHO-expressed)
BK0244-01RecombinantIL-4, His, Rat
BK0252-01RecombinantIL-6, His, Mouse
BK0100-01RecombinantIL-22, Human

Alternative Products

CatalogName
BK0314RecombinantIL-2Rα,His,Human
GTR18990229-01RecombinantIL-2Rα, His, Human
GTR18990525-01RecombinantIL-15, His, Human
GTR18990308-01RecombinantIL-17A, His, Human
BK0234RecombinantIL-17A,His,Human
BK0255RecombinantIL-7,His,Human(CHO-expressed)
GTR18990286RecombinantIL-7, His, Human (CHO-expressed)
PH51151M2IL-2Rβ & IL-2Rγ Heterodimer Protein, Human, Recombinant (His Tag)
HY-P70631-01IL-2R beta/CD122, Human (HEK293, His)
HY-P70556-01IL-2R gamma/CD132, Human (HEK293, His)

Popular Products