Products for Research Use Only
RegisterLogin

RecombinantIL-2Rα, His, Human

CAT: 0013-GTR18990229-01Size: 1 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18990229-01Size:1 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Interleukin-2 receptor (IL-2R) is a heterotrimeric protein expressed on the surface of certain immune cells, such as lymphocytes, that binds and responds to the cytokine IL-2. The IL-2R is made up of 3 subunits - alpha (α), beta (β) and gamma (γ) . The α and β chains are involved in binding IL-2, while signal transduction following cytokine interaction is carried out by the γ-chain, along with the β subunit. The β and γ chains of the IL-2R are members of the type I cytokine receptor family. IL-2R has a high binding affinity to IL-2 and is expressed by antigen-activated T lymphocytes (T cells) . IL-2 Rα is also known as CD25, p55, and Tac (activated T cell) antigen.Recombinant Human Interleukin-2 Receptor α (IL-2 R α), His produced in HEK 293 cells is a polypeptide chain containing 205 amino acids. A fully biologically active molecule, rhIL-2 R α has a molecular mass of 42 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Product Name Alternative
Interleukin-2 Receptor α; IL-2 Rα
Source
HEK 293
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE and HPLC.
Bioactivity
Determined by its ability to increase the proliferation effect of IL-2 in murine CTLL-2 cells. In the presence of 1 ng/ml of recombinant IL-2, ED50 for this effect is < 1.5 μg/ml.
Form
Lyophilized after extensive dialysis against PBS.
Molecular Weight
42 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Human Interleukin-2 Receptor α remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-2 Receptor α should be stable up to 1 week at 4°C or up to 3 months at -20°C.
Notes
For research use only.
Applications Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.
Preservative
Lyophilized after extensive dialysis against PBS.
AA Sequence
HHHHHHHHELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQ KERKTTEMQSPMQPVDQASLPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQ LICTGEMETSQFPGEEKPQASPEGRPESETSC

Related Products

CatalogName
GTR18990525-01RecombinantIL-15, His, Human
GTR18990308-01RecombinantIL-17A, His, Human
GTR18990313-01RecombinantIL-12, His, Rat
GTR18990298-01RecombinantIL-4, His, Rat
GTR18990289-01RecombinantIL-6, His, Mouse
GTR18990286RecombinantIL-7, His, Human (CHO-expressed)
GTR18990300-01RecombinantIL-3, His, Rat
GTR18990284-01RecombinantIL-7, His, Rat
GTR18990285-01RecombinantIL-7, His, Mouse
GTR18990520-01RecombinantIL-1β, Human

Alternative Products

CatalogName
BK0314RecombinantIL-2Rα,His,Human
BK0314-01RecombinantIL-2Rα, His, Human
BK0234RecombinantIL-17A,His,Human
BK0234-01RecombinantIL-17A, His, Human
BK0090-01RecombinantIL-15, His, Human
BK0255RecombinantIL-7,His,Human(CHO-expressed)
BK0255RecombinantIL-7, His, Human (CHO-expressed)
PH51151M2IL-2Rβ & IL-2Rγ Heterodimer Protein, Human, Recombinant (His Tag)
HY-P70631-01IL-2R beta/CD122, Human (HEK293, His)
HY-P70556-01IL-2R gamma/CD132, Human (HEK293, His)

Popular Products