RecombinantAdiponectin/Acrp30, Human

• Description:

  Adipolean/gArcp30 is produced and secreted exclusively by adipocytes, and is a relatively abundant plasma protein, accounting for up to 0.05% of total serum protein. It is an adipocytederived protein with wide ranging paracrine and endocrine effects on metabolism and inflammation. It is induced during adipocyte differentiation, and its secretion is stimulated by insulin. It promotes adipocyte differentiation, fatty acid catabolism, and insulin sensitivity and is negatively correlated with obesity, type 2 diabetes, and atherogenesis.

• Endotoxin:

  < 0.2 EU/μg, determined by LAL method.

• Purity:

  > 95% as analyzed by SDS-PAGE.

• Bioactivity:

  ED50 < 2 μg/ml, measured in a cell proliferation assay using M1 cells.

• Reconstitution:

  Reconstituted in ddH2O or PBS at 100 μg/ml.

• Molecular Weight:

  16~17 kDa, observed by reducing SDS-PAGE.

• Storage Conditions:

  Lyophilized recombinant Human Adipolean/gArcp30 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Adipolean/gArcp30 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

• Appearance:

  Sterile Filtered White lyophilized (freeze-dried) powder.

• Formulation:

  Lyophilized after extensive dialysis against PBS.

• Host or Source:

  HEK 293

• Recommended Usage:

  This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

• CAS Number:

  9000-83-3

• AA Sequence:

  KGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDK AMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN