Acrp30 Human

• Description:

  The Adiponectin Human recombinant protein is a single, non-glycosilated polypeptide chain produced in E. coli, having a molecular weight of 25.1 kDa and containing 231 amino acids (15-244) .

• Swiss Prot:

  Q15848

• Source:

  Escherichia Coli.

• Buffer:

  Acrp30 protein solution contains Phosphate buffered saline pH 7.4 and 1mM DTT.

• Sequence Similarities:

  MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGE