RecombinantNGFR, Human

• Description :

  NGF Receptor, also known as Gp80-LNGFR, p75 ICD, CD271 and TNFRSF16, is a type I transmembrane protein belonging to the TNF receptor family. It is expressed by both neuronal and non-neuronal cells. Signaling through NGF Receptor has been shown to regulate gene expression, cell migration and death. A truncated NGF Receptor containing only the extracellular domain has been detected in plasma, amniotic fluid and urine, and acts as a potent NGF antagonist.

• Endotoxin :

  < 0.2 EU/μg, determined by LAL method.

• Purity :

  > 95% as analyzed by SDS-PAGE.

• Bioactivity :

  ED50 < 0.4 μg /ml, measured in a neutrolization assay using TF-1 cells in the presence of 10ng/ml human b-NGF.

• Reconstitution :

  Reconstituted in ddH2O or PBS at 100 μg/ml.

• Molecular Weight :

  32-60 kDa, observed by reducing SDS-PAGE.

• Storage Conditions :

  Lyophilized recombinant human NGF Receptor remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human NGF Receptor should be stable up to 1 week at 4°C or up to 2 months at -20°C.

• Appearance :

  Sterile Filtered White lyophilized (freeze-dried) powder.

• Formulation :

  Lyophilized after extensive dialysis against PBS.

• Host or Source :

  HEK 293

• Recommended Usage :

  This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

• CAS Number :

  9000-83-3

• AA Sequence :

  KEACPTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCR CAYGYYQDETTGRCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLRECTRWADAEC EEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQPVVTRGTTDN