RecombinantHGF, Human

CAT:
384-BK0220-01
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
RecombinantHGF, Human - image 1

RecombinantHGF, Human

  • Description :

    Hepatocyte Growth Factor (HGF), also known as hepatopoietin-A and scatter factor, is a pleiotropic mitogen belonging to the peptidase S1 family (plasminogen subfamily) . It is produced by mesenchymal cells and acts on epithelial cells, endothelial cells and haemopoietic progenitor cells. HGF binds to the proto-oncogenic c-Met receptor to activate a tyrosine kinase signaling cascade. It regulates cell growth, motility and morphogenesis, thus it plays a pivotal role in angiogenesis, tumorogenesis and tissue regeneration.Recombinant human Hepatocyte Growth Factor (rhHGF) is produced in CHO cells and consists of two polypeptide chains (α-chain and β-chain) held by a single disulfide bond resulting in the formation of a biologically active heterodimer. The α-chain consists of 463 amino acid residues and four kringle domains. The β-chain consists of 234 amino acid residues. A fully biologically active molecule, rhHGF has a molecular mass of around 88-90 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
  • CAS Number :

    9000-83-3
  • Endotoxin :

    < 0.2 EU/μg, determined by LAL method.
  • Purity :

    > 95% as analyzed by SDS-PAGE.
  • Bioactivity :

    ED50 < 10 ng/ml, measured in a cell proliferation assay using 4MBr5 cells, corresponding to a specific activity of > 1x10ˆ5 units/mg.
  • Reconstitution :

    Reconstituted in ddH2O or PBS at 100 μg/ml.
  • Molecular Weight :

    88-90 kDa (single chain), 59-61kDa (alpha chain), 30-34kDa (beta chain), observed by reducing SDS-PAGE.
  • Storage Conditions :

    Lyophilized recombinant humanHepatocyte Growth Factor (HGF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human Hepatocyte Growth Factor (HGF) should be stable up to 1 week at 4°C or up to 2 months at -20°C.
  • Appearance :

    Sterile Filtered White lyophilized (freeze-dried) powder.
  • Formulation :

    Lyophilized after extensive dialysis against PBS.
  • Host or Source :

    CHO
  • Recommended Usage :

    This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
  • AA Sequence :

    QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKE FGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFT SNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWC YTLDPHTRWEYCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRE NYCRNPDGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNMEDLHRHIFWEPD ASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTRTNIGWMVSL RYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLD DFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEG DYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide