Products for Research Use Only
RegisterLogin

RecombinantHCC‑4/CCL16, Human (CHO-expressed)

CAT: 0384-BK0219-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0384-BK0219-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Human HCC­4, also named NCC­4and Chemokine (C-C motif) ligand 16 (CCL16) is a small cytokine belonging to the CC chemokine family that is known under several pseudonyms, including Liver-expressed chemokine (LEC) and Monotactin-1 (MTN-1) . It can signal through the CCR8 and CCR1 receptors, and it is chemotactic towards monocytes and lymphocytes but not neutrophils. HCC-4 is expressed weakly by some lymphocytes, including NK cells, T cells, and some T cell clones. The expression of HCC-4 in monocytes is greatly up-regulated in the presence of IL-10. HCC-4 induces a calcium flux in thp-1 cells that are desensitized prior to the expression of RANTES. Recombinant human HCC‑4/CCL16 produced in CHO cells is a single non-glycosylated polypeptide chain containing 97 amino acids. A fully biologically active molecule, rhHCC‑4/CCL16has a molecular mass of 12 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 98% as analyzed by SDS-PAGE.
Bioactivity
The EC50 value of human HCC‑4/CCL16 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCCR1 cells (human Ga15 and human CCR1 stably expressed in CHO-K1 cells) is less than 1.5 μg/ml.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
12 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant human HCC‑4/CCL16 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human HCC‑4/CCL16 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
CHO
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLST VKIITAKNGQPQLLNSQ

Related Products

CatalogName
BK0264-01RecombinantMCP‑3/CCL7, Human (CHO-expressed)
BK0074-01RecombinantHCC-1/CCL14 (72aa), Human
BK0221-01RecombinantI-309/CCL1, Human (CHO-expressed)
BK0277-01RecombinantNoggin, Human (CHO-expressed)
BK0210-01RecombinantGH, Human (CHO-expressed)
BK0197-01RecombinantEpigen, Human (CHO-expressed)
BK0223-01RecombinantIFN-γ, Human (CHO-expressed)
BK0182-01RecombinantAdiponectin, Human (CHO-expressed)
BK0243-01RecombinantIL-3, Human (CHO-expressed)
BK0267-01RecombinantM-CSF, Human (CHO-expressed)

Alternative Products

CatalogName
BK0219RecombinantHCC‑4/CCL16,Human(CHO-expressed)
GTR18990325-01RecombinantHCC‐4/CCL16, Human (CHO-expressed)
HY-P7196-01HCC-4/CCL16, Human (CHO)
6507-IL-010Recombinant Human IL-4 (CHO-expressed)
6507-IL-010/CFRecombinant Human IL-4 (CHO-expressed) CF
GTR19033678-01Recombinant Human Liver-Expressed Chemokine/CCL16
6507-IL-025/CFRecombinant Human IL-4 (CHO-expressed) Protein CF
7268-CT-100Recombinant Human CTLA-4 Fc Chimera CF (CHO-expressed)
PT_73440-01Interleukin-4 Human Recombinant, CHO (IL 4 Human, CHO)
HY-P7042-01IL-4, Human (CHO)

Popular Products